TkA05G297790 | RubberDandelionOmics

Gene overview

TkA05G297790

Reference: TK1151 Chr: Chr05 Coordinates: 73446961-73448909 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1852 bp · TkA05G297790|TK1151|cDNA

CGTAATTGAATCCAAGAACAGTTTATACAAACCACCACCTATTTATGTAAATTCCAGCCGATAACAATCAAACAGGTTTTAACCTTTCTTGTTCCTAGAAATCAGGAGCTAGATTCTATAAAACCACATAGATTTCGTGATCTAAAACAAATTTAAGGAATCAAAAATGACTAATACCAAATCTATATATCTCCCTCTTCTCGCGCTCCTCGTATCCGTACTTCTCTGTCACACTTTTGCACATGAAAAACCATTCGACC...

CDS

Download CDS FASTA

1530 bp · TkA05G297790|TK1151|CDS

ATGACTAATACCAAATCTATATATCTCCCTCTTCTCGCGCTCCTCGTATCCGTACTTCTCTGTCACACTTTTGCACATGAAAAACCATTCGACCCCAATTGTGTACCTCCGTCAGACCCAAAAAAACACAAACCTCCACCAAACCCACCAATAAAGAAACCTCCACCAATTGACCCCAATTGTATACCTCCAGCAGACCCAAAACCTCCACCAATTGACCCCAATTGTGTACCTCCACCACCACCAATTGACCCCAATTG...

Protein

Download Protein FASTA

509 aa · TkA05G297790|TK1151|PROTEIN

MTNTKSIYLPLLALLVSVLLCHTFAHEKPFDPNCVPPSDPKKHKPPPNPPIKKPPPIDPNCIPPADPKPPPIDPNCVPPPPPIDPNCVPPPPPIDPNCVPPSDPKKQTPPNPQPPPTPTPTPPPPPPQEPKKPEPEDPNKKPPQDPSEPPKPTPFHGIFKGHISAVFAFGDSYTDTGNAQFMGGLKGSFSGSLSSPYGITTFGKTSNRLCDGRLVLDFVTDSLGLPSLPPYQSTTANFTTGANFAIAGATTLAVDLLSKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G297790`
TK1151 ID	TkA05G297790
OH-1004 ID	LXL04_020712
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G297790

Location Chr05:73446961-73448909 (-)

Description Similar to At3g48460: GDSL esterase/lipase At3g48460

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48460`	GDSL esterase/lipase At3g48460.	No verified direct reference in this release
`At2g27360`	GDSL esterase/lipase At2g27360.	No verified direct reference in this release
`At1g28600`	GDSL esterase/lipase At1g28600.	No verified direct reference in this release
`At1g28640`	GDSL esterase/lipase At1g28640.	No verified direct reference in this release
`At1g28670`	GDSL esterase/lipase At1g28670.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020712 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008126 acetylesterase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

GO:0033879 acetylajmaline esterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G28600

ath:AT1G28640

ath:AT3G48460

ath:AT5G45910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.574

Rank 1 · TkA05G297790 · TK1151

Endoplasmic reticulum0.134

Rank 2 · TkA05G297790 · TK1151

Cytoplasm0.126

Rank 3 · TkA05G297790 · TK1151

Lysosome / Vacuole0.094

Rank 4 · TkA05G297790 · TK1151

Cell membrane0.081

Rank 5 · TkA05G297790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL166-491 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G297790	`PF00657`	Lipase_GDSL	166	491	1.9e-26	94.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STM6`	Arabidopsis thaliana	sp\|Q9STM6\|GDL57_ARATH GDSL esterase/lipase At3g48460	40.700%	Swiss-Prot	Medium
`Q9ZQI3`	Arabidopsis thaliana	sp\|Q9ZQI3\|GDL40_ARATH GDSL esterase/lipase At2g27360	33.400%	Swiss-Prot	Medium
`Q94F40`	Arabidopsis thaliana	sp\|Q94F40\|GDL9_ARATH GDSL esterase/lipase At1g28600	35.100%	Swiss-Prot	Medium
`P0C8Z7`	Arabidopsis thaliana	sp\|P0C8Z7\|GDL91_ARATH GDSL esterase/lipase At1g28640	35.300%	Swiss-Prot	Medium
`Q38894`	Arabidopsis thaliana	sp\|Q38894\|GDL13_ARATH GDSL esterase/lipase At1g28670	35.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card