LXL04_020712 | RubberDandelionOmics

Gene overview

LXL04_020712

Reference: OH-1004 Chr: Chr04 Coordinates: 106713678-106715277 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1503 bp · LXL04_020712|LXL04_020712|OH1004|cDNA

ATGACTAATACCAAATCTATATATCTCCCTCTTCTCGCGCTCGTCGTATCCGTACTTCTTTGTCCCACTTTTGCACATGAAAAACCATTCGACCCCAATTGTGTACCTCCGTCAAACCCAAAAAAACACAAACCTCCACCAAACCCACCAATAAAGAAACCTCCACCAATTGACCCCAATTGTATACCTCCAGCAGACCCAAAACCTCCACCAATTGACCCCAATTGTGTACCTCCACCTCCACCAATTGACCCCAATTG...

CDS

Download CDS FASTA

1503 bp · LXL04_020712|LXL04_020712|OH1004|CDS

ATGACTAATACCAAATCTATATATCTCCCTCTTCTCGCGCTCGTCGTATCCGTACTTCTTTGTCCCACTTTTGCACATGAAAAACCATTCGACCCCAATTGTGTACCTCCGTCAAACCCAAAAAAACACAAACCTCCACCAAACCCACCAATAAAGAAACCTCCACCAATTGACCCCAATTGTATACCTCCAGCAGACCCAAAACCTCCACCAATTGACCCCAATTGTGTACCTCCACCTCCACCAATTGACCCCAATTG...

Protein

Download Protein FASTA

500 aa · LXL04_020712|LXL04_020712|OH1004|PROTEIN

MTNTKSIYLPLLALVVSVLLCPTFAHEKPFDPNCVPPSNPKKHKPPPNPPIKKPPPIDPNCIPPADPKPPPIDPNCVPPPPPIDPNCVPPSDPKKQTPPNPQPPPTPTPTPPPPPPQEPKKPEPPPEDPNKKPPQDPSEPPKPTPFHGIFKGHISAVFAFGDSYTDTGNAQFMGGLKGSFSGSLSSPYGITTFGKTSNRLCDGRLVLDFVTDSLGLPSLPPYQSTTANFTTGANFAIAGATTLAVDLLSKIVRTGFLLKG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020712`
TK1151 ID	TkA05G297790
OH-1004 ID	LXL04_020712
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020712

Location Chr04:106713678-106715277 (-)

Description Similar to At3g48460: GDSL esterase/lipase At3g48460

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48460`	GDSL esterase/lipase At3g48460.	No verified direct reference in this release
`At5g45910`	GDSL esterase/lipase At5g45910.	No verified direct reference in this release
`At1g28640`	GDSL esterase/lipase At1g28640.	No verified direct reference in this release
`At1g28600`	GDSL esterase/lipase At1g28600.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020712 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008126 acetylesterase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

GO:0033879 acetylajmaline esterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G28600

ath:AT1G28640

ath:AT3G48460

ath:AT5G45910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.564

Rank 1 · LXL04_020712 · OH-1004

Endoplasmic reticulum0.137

Rank 2 · LXL04_020712 · OH-1004

Cytoplasm0.123

Rank 3 · LXL04_020712 · OH-1004

Lysosome / Vacuole0.094

Rank 4 · LXL04_020712 · OH-1004

Cell membrane0.082

Rank 5 · LXL04_020712 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657.29Lipase_GDSL157-482 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020712	`PF00657.29`	Lipase_GDSL	157	482	1.8e-26	94.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STM6`	Arabidopsis thaliana	GDSL esterase/lipase At3g48460	40.909%	Swiss-Prot	moderate database homology
`Q9FJ45`	Arabidopsis thaliana	GDSL esterase/lipase At5g45910	35.799%	Swiss-Prot	moderate database homology
`P0C8Z7`	Arabidopsis thaliana	GDSL esterase/lipase At1g28640	35.817%	Swiss-Prot	moderate database homology
`Q94F40`	Arabidopsis thaliana	GDSL esterase/lipase At1g28600	34.807%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card