TkA05G289620 | RubberDandelionOmics

Gene overview

TkA05G289620

Reference: TK1151 Chr: Chr05 Coordinates: 71564771-71568635 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

1221 bp · TkA05G289620|TK1151|CDS

ATGATTTTGAAAACGCGAACTAGTCATTATCGGCGCTTCAGGAGCCGAAGGATTTCCGTCAGCGGTTTCGTGCTTGTTACTCTAACTCTGATTTTTCTCATATCCGCTTCTGCTTTCTTCCTCCTTTCCAAAGATGATAAAGATGCAGATAAGGATGAGTACATTGTGGAAGGCGAGGAGTTTGGGAGTGATGTGGACTTCCTGGAAAACGTAACATGTACAGCAAGATCAAAAATGGTAAAGTTTGGGCATGGGAATGG...

Protein

Download Protein FASTA

406 aa · TkA05G289620|TK1151|PROTEIN

MILKTRTSHYRRFRSRRISVSGFVLVTLTLIFLISASAFFLLSKDDKDADKDEYIVEGEEFGSDVDFLENVTCTARSKMVKFGHGNGFVGHGGDSRYWDRDDRRRDNDYGEDLVSNNDSNHIASKTYNNQKKKKRRAGGLYNEAGRNELKMYEAEYEASLKGVSVVSKKTITDEDTDTDDEYIDEIDMHDIRLEDYKDDIPIEAEKQSSRRAISERKIASKKRSKRRKYSGACKMKVVNSSMNAVEPPESSKFVRFSLRY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G289620`
TK1151 ID	TkA05G289620
OH-1004 ID	LXL04_007882
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.300
Protein coverage (%)	TK1151 99.015 / OH-1004 64.791 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G289620

Location Chr05:71564771-71568635 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28240`	Probable glycosyltransferase involved in pectin and/or xylans biosynthesis in cell walls (By similarity).	Identification of Key Enzymes for Pectin Synthesis in Seed Mucilage.2018 · DOI: 10.1104/pp.18.00584

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007882 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0009992 intracellular water homeostasis Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010246 rhamnogalacturonan I biosynthetic process Biological Process

GO:0045491 xylan metabolic process Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:1902456 regulation of stomatal opening Biological Process

GO:0000139 Golgi membrane Cellular Component

KEGG gene cross-reference

ath:AT1G28240

ath:AT5G46220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.608

Rank 1 · TkA05G289620 · TK1151

Endoplasmic reticulum0.139

Rank 2 · TkA05G289620 · TK1151

Cell membrane0.106

Rank 3 · TkA05G289620 · TK1151

Nucleus0.092

Rank 4 · TkA05G289620 · TK1151

Cytoplasm0.069

Rank 5 · TkA05G289620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08297U3_snoRNA_assoc121-135 aa

PF08297U3_snoRNA_assoc192-255 aa

PF04765TOD1_MUCI70262-405 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G289620	`PF08297`	U3_snoRNA_assoc	121	135	0.14	13.6
TkA05G289620	`PF08297`	U3_snoRNA_assoc	192	255	0.14	13.6
TkA05G289620	`PF04765`	TOD1_MUCI70	262	405	6.5e-52	177.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ97`	Arabidopsis thaliana	sp\|Q9FZ97\|MUC70_ARATH Probable hexosyltransferase MUCI70	40.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card