TkA05G281180 | RubberDandelionOmics

Gene overview

TkA05G281180

Reference: TK1151 Chr: Chr05 Coordinates: 69496588-69500255 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA05G281180|TK1151|cDNA

ATGATTGACCAAGATGTTGAGCCCGACACAACCATCAAACTACTTCAAAAGGAGAAATCCCCAAAGAAAGGTGAACACATCATTCCATGCTGCAAACGGCGTTGGATTCCTCCTCAAACTGTTTCTGCTGCTACATTTACACCTTCCACTGTGATCAAGAAGAAGAAGAAGATAAATCAGACTCCAAGCAAATTGCCAAAGCCAAATTCAAAGCTGGATGTTGGGGTAGTTGAGATGAAAGTTGTGATTGAAAGTACAGG...

CDS

Download CDS FASTA

588 bp · TkA05G281180|TK1151|CDS

ATGATTGACCAAGATGTTGAGCCCGACACAACCATCAAACTACTTCAAAAGGAGAAATCCCCAAAGAAAGGTGAACACATCATTCCATGCTGCAAACGGCGTTGGATTCCTCCTCAAACTGTTTCTGCTGCTACATTTACACCTTCCACTGTGATCAAGAAGAAGAAGAAGATAAATCAGACTCCAAGCAAATTGCCAAAGCCAAATTCAAAGCTGGATGTTGGGGTAGTTGAGATGAAAGTTGTGATTGAAAGTACAGG...

Protein

Download Protein FASTA

195 aa · TkA05G281180|TK1151|PROTEIN

MIDQDVEPDTTIKLLQKEKSPKKGEHIIPCCKRRWIPPQTVSAATFTPSTVIKKKKKINQTPSKLPKPNSKLDVGVVEMKVVIESTGGLVVLVESFGRSVFKDSFRRVFKKGEESLGLSHNGTLEINCREHNDWTGEHKDAHFVVVRVLETVAAYPAPAIDQEINSHLSSIVNEVVDKQLTAALSKQEERLIAIE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G281180`
TK1151 ID	TkA05G281180
OH-1004 ID	LXL04_011937
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.900
Protein coverage (%)	TK1151 35.897 / OH-1004 22.654 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G281180

Location Chr05:69496588-69500255 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14160`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER).	No verified direct reference in this release
`At1g05520`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER) (By similarity).	No verified direct reference in this release
`At3g23660`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER).	No verified direct reference in this release
`At2g21630`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER) (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011937 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003400 regulation of COPII vesicle coating Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0061709 reticulophagy Biological Process

GO:0070863 positive regulation of protein exit from endoplasmic reticulum Biological Process

GO:0090110 COPII-coated vesicle cargo loading Biological Process

GO:1902953 positive regulation of ER to Golgi vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0030127 COPII vesicle coat Cellular Component

KEGG gene cross-reference

ath:AT1G05520

ath:AT2G21630

ath:AT3G23660

ath:AT4G14160

dha:DEHA2E02332g

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.719

Rank 1 · TkA05G281180 · TK1151

Cytoplasm0.313

Rank 2 · TkA05G281180 · TK1151

Mitochondrion0.035

Rank 3 · TkA05G281180 · TK1151

Cell membrane0.034

Rank 4 · TkA05G281180 · TK1151

Endoplasmic reticulum0.023

Rank 5 · TkA05G281180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04811Sec23_trunk74-109 aa

PF20728Nairovirus_NSm77-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G281180	`PF04811`	Sec23_trunk	74	109	0.00045	20.6
TkA05G281180	`PF20728`	Nairovirus_NSm	77	102	0.2	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VXX0`	Arabidopsis thaliana	sp\|Q8VXX0\|SC23F_ARATH Protein transport protein SEC23 F	78.200%	Swiss-Prot	Low
`Q8H0S3`	Arabidopsis thaliana	sp\|Q8H0S3\|SC23B_ARATH Protein transport protein SEC23 B	76.400%	Swiss-Prot	Low
`Q9LUG1`	Arabidopsis thaliana	sp\|Q9LUG1\|SC23E_ARATH Protein transport protein SEC23 E	72.700%	Swiss-Prot	Low
`Q9SIJ7`	Arabidopsis thaliana	sp\|Q9SIJ7\|SC23C_ARATH Protein transport protein SEC23 C	61.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card