RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G246280
Reference: TK1151 Chr: Chr05 Coordinates: 61252992-61254784 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1233 bp · TkA05G246280|TK1151|cDNA

ATGCTGGAAGCAATTAAGTTCATGAGTGCAGACCAAAGAGATGCAGTGGCTGAAATGGGTTTTGGAGCATTCCTGGATATGAAGATGGAACAATGCCCTGCAAAACTGGGACATTTTCTGGTTGAGAATTTAGATGACAAAAACTTGGTGTTGAGGACTGGGAAAAGGGATATCAAACTGACAACAGATGTTGTGCATGAAGTATTTGGAATACCCAATGGAGGTCTAGACATAGACAACATCAAACCAGTTAAAAGAGC...

CDS

Download CDS FASTA

1233 bp · TkA05G246280|TK1151|CDS

ATGCTGGAAGCAATTAAGTTCATGAGTGCAGACCAAAGAGATGCAGTGGCTGAAATGGGTTTTGGAGCATTCCTGGATATGAAGATGGAACAATGCCCTGCAAAACTGGGACATTTTCTGGTTGAGAATTTAGATGACAAAAACTTGGTGTTGAGGACTGGGAAAAGGGATATCAAACTGACAACAGATGTTGTGCATGAAGTATTTGGAATACCCAATGGAGGTCTAGACATAGACAACATCAAACCAGTTAAAAGAGC...

Protein

Download Protein FASTA

410 aa · TkA05G246280|TK1151|PROTEIN

MLEAIKFMSADQRDAVAEMGFGAFLDMKMEQCPAKLGHFLVENLDDKNLVLRTGKRDIKLTTDVVHEVFGIPNGGLDIDNIKPVKRANEIFKLWKSQYPENIARTKILERIRETDDDGIVFKLNFITLFVNCFCETYTSGFFRGSKNNWVPNDVTSIYAGPITFLMLTRGPEDNIPRIPPAIEAWDFDMVKRREKKELERGGFRCFKEDGDQDLPEVVVRENTREICRYEAELLDTFWKYLDKDPQDEEILNLKEEFHIM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G246280
TK1151 IDTkA05G246280
OH-1004 IDLXL04_020540
Relationship / confidenceMulti Candidate From Tk1151 / Complex relationship
Protein identity (%)94.600
Protein coverage (%)TK1151 100.000 / OH-1004 55.435
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G246280
LocationChr05:61252992-61254784 (-)
DescriptionSimilar to hmu: Halomucin (Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_020540 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006508 proteolysis Biological Process
GO:0007156 homophilic cell-cell adhesion Biological Process
GO:0019079 viral genome replication Biological Process
GO:0019082 viral protein processing Biological Process
GO:0032259 methylation Biological Process
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway Biological Process
GO:0039520 symbiont-mediated activation of host autophagy Biological Process
GO:0039548 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity Biological Process
GO:0039579 symbiont-mediated suppression of host ISG15-protein conjugation Biological Process
GO:0039595 symbiont-mediated degradation of host mRNA Biological Process
GO:0039648 symbiont-mediated perturbation of host ubiquitin-like protein modification Biological Process
GO:0039657 symbiont-mediated suppression of host gene expression Biological Process
KEGG gene cross-reference
hwa:HQ_1081A
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.605
Rank 1 · TkA05G246280 · TK1151
Cytoplasm0.310
Rank 2 · TkA05G246280 · TK1151
Extracellular0.074
Rank 3 · TkA05G246280 · TK1151
Mitochondrion0.041
Rank 4 · TkA05G246280 · TK1151
Cell membrane0.040
Rank 5 · TkA05G246280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29561DUF85663-140 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G246280PF29561DUF856631406.2e-29102.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser