TkA05G154670 | RubberDandelionOmics

Gene overview

TkA05G154670

Reference: TK1151 Chr: Chr05 Coordinates: 40047747-40058229 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2458 bp · TkA05G154670|TK1151|cDNA

TATTAATTTGTGGTTGAGTAAAGATTTGAAAATGCATACAAGGAGAAGTGAAGATGTTTCGTTAGAAGAAGAAGAAGAACAAAACAACTCATTGCGATGCCGACAATCAGGCGATAGTGGCAGTGGTACCGTCACCGGTCGGTTTCTTATTCATCCACAAAATCGGTAATATTATTATCCACTTGTTTCAGTTTAAATTCACATGGTTATCCACATATATATTCAATTAATTAGTCACGGAAGATTTGAGATTTTGTTAT...

CDS

Download CDS FASTA

1743 bp · TkA05G154670|TK1151|CDS

ATGGAGTTTTTTATCCATAAATGGCCGAGTAAAGATTTGAAAATGCATACAAGGAGAAGTGAAGATGTTTCGTTAGAAAAAGAAGAAGAACAAAACAACTCATTGCGATGTCGACAATCAGGCGATAGTGGCGATAGTGGCAGTGGTACCGTCACCGGTCGGTTTCTTATTCATCCACAAAATCGGTGGTATATAGCATGGAAGCAATTCATCTTGATATGGGCGATATACTCGTCGTTCTTCACACCCCTCGAGTTCGG...

Protein

Download Protein FASTA

580 aa · TkA05G154670|TK1151|PROTEIN

MEFFIHKWPSKDLKMHTRRSEDVSLEKEEEQNNSLRCRQSGDSGDSGSGTVTGRFLIHPQNRWYIAWKQFILIWAIYSSFFTPLEFGFCRGLPENLFLLDIAGQLAFFIDIVLHFFVTYKDSHSHLLVRSHNLIAIRYLKSRFLLDFMGCLPLDAIYKACNRLEPVRYLLWIRLSRALRVTEFFEELEKDIRINYLFTRIIKRFVVELYCTHTAACIFYYLATTLPPTKEGYTWIGSLKMGDYSYSQFREIDLWTRYITS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G154670`
TK1151 ID	TkA05G154670
OH-1004 ID	LXL04_024848
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.900
Protein coverage (%)	TK1151 88.793 / OH-1004 58.192 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G154670

Location Chr05:40047747-40058229 (+)

Description Similar to SKOR: Potassium channel SKOR

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02850`	Highly selective outward-rectifying potassium channel.	Identification and disruption of a plant shaker-like outward channel involved in K+ release into the xylem sap.1998 · DOI: 10.1016/s0092-8674(00)81606-2
`At5g37500`	Major selective outward-rectifying potassium channel of the guard cell membrane.	The Arabidopsis outward K+ channel GORK is involved in regulation of stomatal movements and plant transpiration.2003 · DOI: 10.1073/pnas.0733970100
`At2g26650`	May act as a highly selective inward-rectifying potassium channel mediating root potassium uptake under low K⁺ conditions.	Regulated expression of Arabidopsis shaker K+ channel genes involved in K+ uptake and distribution in the plant.2003 · DOI: 10.1023/a:1022597102282 A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011 A Ca(2)+ signaling pathway regulates a K(+) channel for low-K response in Arabidopsis.2006 · DOI: 10.1073/pnas.0605129103 A protein phosphorylation/dephosphorylation network regulates a plant potassium channel.2007 · DOI: 10.1073/pnas.0707912104 High-affinity K(+) transport in Arabidopsis: AtHAK5 and AKT1 are vital for seedling establishment and postgermination growth under low-potassium conditions.2010 · DOI: 10.1104/pp.110.154369 A role for the AKT1 potassium channel in plant nutrition.1998 · DOI: 10.1126/science.280.5365.918
`At4g32650`	Probable modulatory (alpha) subunit of inward-rectifying potassium channels.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0250600`	Probable outward-rectifying potassium channel.	No verified direct reference in this release
`Os04g0445000`	Probable outward-rectifying potassium channel.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024848 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0006813 potassium ion transport Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010118 stomatal movement Biological Process

GO:0048767 root hair elongation Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0090333 regulation of stomatal closure Biological Process

KEGG gene cross-reference

ath:AT2G26650

ath:AT3G02850

ath:AT5G37500

dosa:Os04g0445000

dosa:Os06g0250600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.710

Rank 1 · TkA05G154670 · TK1151

Cytoplasm0.162

Rank 2 · TkA05G154670 · TK1151

Endoplasmic reticulum0.106

Rank 3 · TkA05G154670 · TK1151

Lysosome / Vacuole0.072

Rank 4 · TkA05G154670 · TK1151

Golgi apparatus0.053

Rank 5 · TkA05G154670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520Ion_trans66-314 aa

PF07885Ion_trans_2254-310 aa

PF00027cNMP_binding406-489 aa

PF07292NID451-493 aa

PF13637Ank_4537-567 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G154670	`PF00520`	Ion_trans	66	314	4.4e-27	95.5
TkA05G154670	`PF07885`	Ion_trans_2	254	310	5.1e-10	39.8
TkA05G154670	`PF00027`	cNMP_binding	406	489	2.5e-12	47.3
TkA05G154670	`PF07292`	NID	451	493	0.22	12.8
TkA05G154670	`PF13637`	Ank_4	537	567	0.2	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8S6`	Arabidopsis thaliana	sp\|Q9M8S6\|SKOR_ARATH Potassium channel SKOR	65.600%	Swiss-Prot	High
`Q94A76`	Arabidopsis thaliana	sp\|Q94A76\|GORK_ARATH Potassium channel GORK	63.200%	Swiss-Prot	High
`Q38998`	Arabidopsis thaliana	sp\|Q38998\|AKT1_ARATH Potassium channel AKT1	33.700%	Swiss-Prot	Medium
`P92960`	Arabidopsis thaliana	sp\|P92960\|KAT3_ARATH Potassium channel KAT3	39.900%	Swiss-Prot	Medium
`Q653P0`	Oryza sativa subsp. japonica	sp\|Q653P0\|KOR1_ORYSJ Potassium channel KOR1	65.400%	Swiss-Prot	High
`Q7XUW4`	Oryza sativa subsp. japonica	sp\|Q7XUW4\|KOR2_ORYSJ Potassium channel KOR2	55.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card