TkA05G102580 | RubberDandelionOmics

Gene overview

TkA05G102580

Reference: TK1151 Chr: Chr05 Coordinates: 27539381-27540353 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

814 bp · TkA05G102580|TK1151|cDNA

AACACTACTAAAATTTATGTAGGACCACGAGTTAAAAAACAATGGGCTGGACTCCAATCTTTGGCAATGTCCAGTTCAGTAGGGTATCGGAAGTAACAGAGCTTGCTGCCAGCCGCACAACGCTACGACGCTTTACGCCGCGGCGCCGGCCGGAGGTCCAAAGTCAGTTCATCACATATATATGGCAGCTAGTTCCATCGTGTTAACTGAACTCCATAGAAAGTCAACCAGCTGGGCTAACGTAGTCGATGAAATAGTAA...

CDS

Download CDS FASTA

480 bp · TkA05G102580|TK1151|CDS

ATGGCAGCTAGTTCCATCGTGTTAACTGAACTCCATAGAAAGTCAACCAGCTGGGCTAACGTAGTCGATGAAATAGTAAGGCTAGAGAAGAAGATTTTCCCCAAACACGAATCACTCGCTCGATCGTTCGATGATGAACTCAAGAAGAAGAACAGCGGTTTAATCTATTTGGAAATTAATGGAGGTCTTGCTGGCTATGTCATGTATTCATGTCCTTCTTCACTTTGTGTCATCATCACTAAACTCGCAGTGAAGGAGGA...

Protein

Download Protein FASTA

159 aa · TkA05G102580|TK1151|PROTEIN

MAASSIVLTELHRKSTSWANVVDEIVRLEKKIFPKHESLARSFDDELKKKNSGLIYLEINGGLAGYVMYSCPSSLCVIITKLAVKEDYRRQGHGDTLLQAAMEKCRSKRIHRISLHVDPLRTSAMHLYKKHGFQIDTLVKAYYSSDRDAYRMYLDFDKE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G102580`
TK1151 ID	TkA05G102580
OH-1004 ID	LXL04_019897
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G102580`
Location	Chr05:27539381-27540353 (+)
Description	Similar to STK_02580: N-alpha-acetyltransferase (Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019897` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0046677 response to antibiotic Biological Process GO:0005737 cytoplasm Cellular Component GO:0031415 NatA complex Cellular Component GO:0004596 protein-N-terminal amino-acid acetyltransferase activity Molecular Function GO:0008999 protein-N-terminal-alanine acetyltransferase activity Molecular Function GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function GO:0046872 metal ion binding Molecular Function GO:0047921 aminoglycoside 2'-N-acetyltransferase activity Molecular Function GO:0120518 protein N-terminal-methionine acetyltransferase activity Molecular Function GO:1990189 protein N-terminal-serine acetyltransferase activity Molecular Function
KEGG gene cross-reference	bsu:BSU05930 bsu:BSU40740 sai:Saci_0459 sso:SSO0209 sto:STK_02580 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.678

Rank 1 · TkA05G102580 · TK1151

Nucleus0.355

Rank 2 · TkA05G102580 · TK1151

Mitochondrion0.066

Rank 3 · TkA05G102580 · TK1151

Cell membrane0.055

Rank 4 · TkA05G102580 · TK1151

Endoplasmic reticulum0.048

Rank 5 · TkA05G102580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02346Vac_Fusion20-41 aa

PF00583Acetyltransf_127-133 aa

PF13673Acetyltransf_1033-134 aa

PF13420Acetyltransf_451-146 aa

PF13508Acetyltransf_754-134 aa

PF14542Acetyltransf_CG60-109 aa

PF13302Acetyltransf_363-134 aa

PF13527Acetyltransf_976-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G102580	`PF02346`	Vac_Fusion	20	41	0.043	14.4
TkA05G102580	`PF00583`	Acetyltransf_1	27	133	1.3e-18	68.1
TkA05G102580	`PF13673`	Acetyltransf_10	33	134	8.9e-11	42.6
TkA05G102580	`PF13420`	Acetyltransf_4	51	146	0.0081	16.9
TkA05G102580	`PF13508`	Acetyltransf_7	54	134	8e-14	52.5
TkA05G102580	`PF14542`	Acetyltransf_CG	60	109	0.00024	21.9
TkA05G102580	`PF13302`	Acetyltransf_3	63	134	0.2	13.1
TkA05G102580	`PF13527`	Acetyltransf_9	76	134	0.0012	19.5
TkA05G102580	`PF17013`	Acetyltransf_15	76	140	0.03	14.4
TkA05G102580	`PF08445`	FR47	78	136	3.3e-06	27.7
TkA05G102580	`PF02346`	Vac_Fusion	105	134	0.043	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card