Gene Card
Gene overview
cDNA / CDS / Protein Sequences
480 bp · LXL04_019897|LXL04_019897|OH1004|cDNA
ATGGCAGGTAGTTCCATCGTGTTGACTGAACTCCATAGAAAGTCAACCAGCTGGGCTAACGTAGTCGATGAAATAGTAAGGCTAGAAAAGAAGATTTTCCCCAAACACGAATCACTTGCTCGATCGTTCGATGATGAACTCAAGAAGAAGAACAGCGGTTTAATCTATTTGGAAATTAATGGCGGTCTTGCTGGCTATGTCATGTATTCATGTCCTTCTTCACTTTGTGCCATCATCACTAAACTCGCAGTGAAGGAGGA...
480 bp · LXL04_019897|LXL04_019897|OH1004|CDS
ATGGCAGGTAGTTCCATCGTGTTGACTGAACTCCATAGAAAGTCAACCAGCTGGGCTAACGTAGTCGATGAAATAGTAAGGCTAGAAAAGAAGATTTTCCCCAAACACGAATCACTTGCTCGATCGTTCGATGATGAACTCAAGAAGAAGAACAGCGGTTTAATCTATTTGGAAATTAATGGCGGTCTTGCTGGCTATGTCATGTATTCATGTCCTTCTTCACTTTGTGCCATCATCACTAAACTCGCAGTGAAGGAGGA...
Protein
Download Protein FASTA159 aa · LXL04_019897|LXL04_019897|OH1004|PROTEIN
MAGSSIVLTELHRKSTSWANVVDEIVRLEKKIFPKHESLARSFDDELKKKNSGLIYLEINGGLAGYVMYSCPSSLCAIITKLAVKEDYRRQGHGDTLLQAAMEKCRSKRIHRISLHVDPLRTSAMHLYKKHGFQIDTLVKAYYSSDRDAYRMYLDFDKE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_019897 |
|---|---|
| TK1151 ID | TkA05G102580 |
| OH-1004 ID | LXL04_019897 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_019897 |
|---|---|
| Location | Chr04:43602024-43602662 (+) |
| Description | Similar to STK_02580: N-alpha-acetyltransferase (Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0046677 response to antibiotic Biological Process GO:0005737 cytoplasm Cellular Component GO:0031415 NatA complex Cellular Component GO:0004596 protein-N-terminal amino-acid acetyltransferase activity Molecular Function GO:0008999 protein-N-terminal-alanine acetyltransferase activity Molecular Function GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function GO:0046872 metal ion binding Molecular Function GO:0047921 aminoglycoside 2'-N-acetyltransferase activity Molecular Function GO:0120518 protein N-terminal-methionine acetyltransferase activity Molecular Function GO:1990189 protein N-terminal-serine acetyltransferase activity Molecular Function |
| KEGG gene cross-reference | bsu:BSU05930 bsu:BSU40740 sai:Saci_0459 sso:SSO0209 sto:STK_02580 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00583.32Acetyltransf_127-133 aaPF13673.14Acetyltransf_1033-134 aaPF13508.14Acetyltransf_754-134 aaPF08445.17FR4777-136 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_019897 | PF00583.32 | Acetyltransf_1 | 27 | 133 | 6.6e-19 | 69.0 |
| LXL04_019897 | PF13673.14 | Acetyltransf_10 | 33 | 134 | 8.8e-11 | 42.6 |
| LXL04_019897 | PF13508.14 | Acetyltransf_7 | 54 | 134 | 5.9e-14 | 52.9 |
| LXL04_019897 | PF08445.17 | FR47 | 77 | 136 | 2e-06 | 28.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.