TkA05G070900 | RubberDandelionOmics

Gene overview

TkA05G070900

Reference: TK1151 Chr: Chr05 Coordinates: 18941896-18945767 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1362 bp · TkA05G070900|TK1151|cDNA

CAGGTTGCTTTTTGTTAAAAAACAATTAATTGTTTTTAAAGAATTATTCCTCACATGGAGGGGGCCACTTGGACGACTAAAAGCAGAATCAACGTCAACGTAATTATTGAGGACCATGCTTCTACATTTATTCAAAGTAAGTCACCAACTTATCAGCCGATCCAAATGTGTTATTCTAGCTCTCAAGCTTAACTAATACTTTTGAGATTTCAATGGCGGACGCTGCTGTGGAATTCCTGCTGGGTAATCTGAAACAACTG...

CDS

Download CDS FASTA

942 bp · TkA05G070900|TK1151|CDS

ATGGCGGACGCTGCTGTGGAATTCCTGCTGGGTAATCTGAAACAACTGCTAGTATACAACGCCAATTTGATCTCAAGCGTCAAAGATCAAGTCGACTCTTTGTACAACGACCTCCGTCTACTGGCAGCTTTCGTGAAGGAAACCACCGAGAGCCGAAGCAAGCACACCGTCGTCAAAGAACTGGTCAGACGCATCAGAATCGAAGTGTACAAAGCTGAAGACATTGTCGACATGTACGTCTTCCACGCATCGGTCCACAA...

Protein

Download Protein FASTA

314 aa · TkA05G070900|TK1151|PROTEIN

MADAAVEFLLGNLKQLLVYNANLISSVKDQVDSLYNDLRLLAAFVKETTESRSKHTVVKELVRRIRIEVYKAEDIVDMYVFHASVHKSRTSLEKALHFTEYPMKLRTVGKEIEDIRRRVKEIYDNKLIANEVFRKTESFTRSPPCVEEDNVVGFDKETEKVVGWLTAETEELEVIYVVGMGGLGKTTLAKKVFKSSSIQYEFFIRSWVYVSQVYSRREVFLKILYDVTRENRDTSQWSVETIADELHSHTTRNWGLYLRT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G070900`
TK1151 ID	TkA05G070900
OH-1004 ID	LXL04_019647
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.500
Protein coverage (%)	TK1151 78.981 / OH-1004 27.241 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G070900

Location Chr05:18941896-18945767 (-)

Description Similar to R1A-6: Putative late blight resistance protein homolog R1A-6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50180`	Potential disease resistance protein.	No verified direct reference in this release
`At1g58390`	Possible disease resistance protein.	No verified direct reference in this release
`At1g58848`	Potential disease resistance protein.	No verified direct reference in this release
`At1g59218`	Potential disease resistance protein.	No verified direct reference in this release
`At1g58807`	Potential disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019647 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0051607 defense response to virus Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.604

Rank 1 · TkA05G070900 · TK1151

Endoplasmic reticulum0.159

Rank 2 · TkA05G070900 · TK1151

Cytoplasm0.121

Rank 3 · TkA05G070900 · TK1151

Lysosome / Vacuole0.075

Rank 4 · TkA05G070900 · TK1151

Nucleus0.064

Rank 5 · TkA05G070900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18052Rx_N5-93 aa

PF27407YubE21-39 aa

PF13173AAA_1429-65 aa

PF13401AAA_2245-62 aa

PF01637ATPase_245-67 aa

PF25201nSTAND653-64 aa

PF24883NPHP3_N54-65 aa

PF13238AAA_1856-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G070900	`PF18052`	Rx_N	5	93	2.2e-15	57.3
TkA05G070900	`PF27407`	YubE	21	39	1.3	10.0
TkA05G070900	`PF13173`	AAA_14	29	65	0.032	14.9
TkA05G070900	`PF13401`	AAA_22	45	62	0.00051	21.1
TkA05G070900	`PF01637`	ATPase_2	45	67	0.0087	16.6
TkA05G070900	`PF25201`	nSTAND6	53	64	0.0021	18.8
TkA05G070900	`PF24883`	NPHP3_N	54	65	0.031	15.2
TkA05G070900	`PF13238`	AAA_18	56	76	0.034	15.4
TkA05G070900	`PF02374`	ArsA_ATPase	80	148	0.12	12.3
TkA05G070900	`PF27407`	YubE	91	133	1.3	10.0
TkA05G070900	`PF00448`	SRP54	97	121	0.064	13.6
TkA05G070900	`PF18052`	Rx_N	103	121	2.2e-15	57.3
TkA05G070900	`PF13173`	AAA_14	111	126	0.032	14.9
TkA05G070900	`PF00931`	NB-ARC	155	248	4.3e-19	69.4
TkA05G070900	`PF02367`	TsaE	156	206	0.014	16.1
TkA05G070900	`PF01637`	ATPase_2	157	219	0.0087	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX38`	Arabidopsis thaliana	sp\|Q9SX38\|DRL4_ARATH Putative disease resistance protein At1g50180	32.100%	Swiss-Prot	Medium
`Q8W474`	Arabidopsis thaliana	sp\|Q8W474\|DRL7_ARATH Probable disease resistance protein At1g58390	30.500%	Swiss-Prot	Medium
`P0DI17`	Arabidopsis thaliana	sp\|P0DI17\|DRL11_ARATH Probable disease resistance protein RF9	28.100%	Swiss-Prot	Low
`P0DI18`	Arabidopsis thaliana	sp\|P0DI18\|DRL45_ARATH Probable disease resistance protein RDL6	28.100%	Swiss-Prot	Low
`F4IBE4`	Arabidopsis thaliana	sp\|F4IBE4\|DRL10_ARATH Probable disease resistance protein RF45	27.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card