TkA05G058010 | RubberDandelionOmics

Gene overview

TkA05G058010

Reference: TK1151 Chr: Chr05 Coordinates: 15444008-15445789 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1332 bp · TkA05G058010|TK1151|cDNA

ATGGCGGCCAATATATATCCGAATTCCTCACCACATTCCCAGGTACAACTTGTCTGTAACAATGAAGTTGCACTTGGTTATATTGATTTCGTTAGCATCAGAAGCAACATCAGCAGCGATTTACTCGAGGCCCGGATGCAAAGATATGTGCGGGGAAGTCCGGATTCCGTACCCATTCGGAATCTGTACAGGGTGCTATATCAACGAATGACGGTGGCAGTTAATGTCTCAATGAGTTCTAATTGTATCGACCCAATCCA...

CDS

Download CDS FASTA

1332 bp · TkA05G058010|TK1151|CDS

ATGGCGGCCAATATATATCCGAATTCCTCACCACATTCCCAGGTACAACTTGTCTGTAACAATGAAGTTGCACTTGGTTATATTGATTTCGTTAGCATCAGAAGCAACATCAGCAGCGATTTACTCGAGGCCCGGATGCAAAGATATGTGCGGGGAAGTCCGGATTCCGTACCCATTCGGAATCTGTACAGGGTGCTATATCAACGAATGACGGTGGCAGTTAATGTCTCAATGAGTTCTAATTGTATCGACCCAATCCA...

Protein

Download Protein FASTA

443 aa · TkA05G058010|TK1151|PROTEIN

MAANIYPNSSPHSQVQLVCNNEVALGYIDFVSIRSNISSDLLEARMQRYVRGSPDSVPIRNLYRVLYQRMTVAVNVSMSSNCIDPIQNSSQILSIDLGVEMQLSWSKGTCSQGLQQQSPGGVCGSAFLVDEQMYRFSGQSAIVNNSFVSVSLRWTLGLEDIGEGDCSSMERETLCLGNGTNIESYKCTCLPDEKGSPYLTNGCQGQGTVYKGMLTDGRIVAVKKIKIVDKSQLEQFINEVVILSQVNHRNVVKLLGCCLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G058010`
TK1151 ID	TkA05G058010
OH-1004 ID	LXL04_019525
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	52.000
Protein coverage (%)	TK1151 83.070 / OH-1004 62.836 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G058010

Location Chr05:15444008-15445789 (-)

Description Similar to WAKL1: Wall-associated receptor kinase-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16120`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g16160`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	Tissue-specific and developmentally regulated expression of a cluster of tandemly arrayed cell wall-associated kinase-like kinase genes in Arabidopsis.2003 · DOI: 10.1104/pp.103.028530
`At1g16130`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g79670`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	RESISTANCE TO FUSARIUM OXYSPORUM 1, a dominant Arabidopsis disease-resistance gene, is not race specific.2005 · DOI: 10.1534/genetics.105.042218
`At1g16150`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019525 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004383 guanylate cyclase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G16120

ath:AT1G16130

ath:AT1G16260

ath:AT1G79670

ath:AT1G79680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.620

Rank 1 · TkA05G058010 · TK1151

Cytoplasm0.210

Rank 2 · TkA05G058010 · TK1151

Nucleus0.190

Rank 3 · TkA05G058010 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkA05G058010 · TK1151

Lysosome / Vacuole0.038

Rank 5 · TkA05G058010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12661hEGF108-111 aa

PF12661hEGF175-191 aa

PF07714PK_Tyr_Ser-Thr206-350 aa

PF00069Pkinase206-354 aa

PF03109ABC1207-237 aa

PF03109ABC1306-348 aa

PF07714PK_Tyr_Ser-Thr399-425 aa

PF00069Pkinase401-422 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G058010	`PF12661`	hEGF	108	111	0.78	11.0
TkA05G058010	`PF12661`	hEGF	175	191	0.78	11.0
TkA05G058010	`PF07714`	PK_Tyr_Ser-Thr	206	350	3.9e-30	105.7
TkA05G058010	`PF00069`	Pkinase	206	354	5.1e-30	105.5
TkA05G058010	`PF03109`	ABC1	207	237	0.0049	16.8
TkA05G058010	`PF03109`	ABC1	306	348	0.0049	16.8
TkA05G058010	`PF07714`	PK_Tyr_Ser-Thr	399	425	3.9e-30	105.7
TkA05G058010	`PF00069`	Pkinase	401	422	5.1e-30	105.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9M5`	Arabidopsis thaliana	sp\|Q9S9M5\|WAKLA_ARATH Wall-associated receptor kinase-like 1	56.300%	Swiss-Prot	Medium
`Q9S9M1`	Arabidopsis thaliana	sp\|Q9S9M1\|WAKLE_ARATH Wall-associated receptor kinase-like 5	53.300%	Swiss-Prot	Medium
`Q7X8C5`	Arabidopsis thaliana	sp\|Q7X8C5\|WAKLB_ARATH Wall-associated receptor kinase-like 2	53.900%	Swiss-Prot	Medium
`Q8RY17`	Arabidopsis thaliana	sp\|Q8RY17\|WAKLI_ARATH Wall-associated receptor kinase-like 22	52.200%	Swiss-Prot	Medium
`Q9S9M2`	Arabidopsis thaliana	sp\|Q9S9M2\|WAKLD_ARATH Wall-associated receptor kinase-like 4	53.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card