TkA05G047270 | RubberDandelionOmics

Gene overview

TkA05G047270

Reference: TK1151 Chr: Chr05 Coordinates: 12461739-12471425 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1501 bp · TkA05G047270|TK1151|cDNA

ATTTAAAAGCTACATCTCTTTTCTTTCCTGTAAAATGAAATCAAGACCACTGCACATACATCTTTCATGTCCTATAAATAGGCATAAAAACTGATATCCGATCAAACGGTCTCAACAGATTTGTATGCCTCGTAAGGCCCAAATTCAAGAAAGTTAAATCCCGAACTGAATCATCGGAAAATAAGTTCAAACATGACCGCTGGACCGATATTCTTGACGGAGTCTCCCCTCGCCGGAGATCTTTGTGCCTTGGTTTTCTC...

CDS

Download CDS FASTA

750 bp · TkA05G047270|TK1151|CDS

ATGACCGCTGGACCGATATTCTTGACGGAGTCTCCCCTCGCCGGAGATCTTTGTGCCTTGGTTTTCTCCACTTGTATCGCACTCTCTCTGCTTCGATGCTTTGAAGAAACTGCAAAAAGAGGGATTTTCGATCAGAAACTAAACAGGAAGCTCGTGCATATAACAATTGGACTGGCATTCATGTTATGCTGGCCGCTCTTCAGTTCAGGCAGTCAAGGAGCATTCATTGCAGCTATTGTTCCCGGAGTGAACATAGTGAA...

Protein

Download Protein FASTA

249 aa · TkA05G047270|TK1151|PROTEIN

MTAGPIFLTESPLAGDLCALVFSTCIALSLLRCFEETAKRGIFDQKLNRKLVHITIGLAFMLCWPLFSSGSQGAFIAAIVPGVNIVKMLLIGNGIVKDEATVKSMSRFGDYRELLTGPLYYACTITLCCTVYWRTSPIAIAAMCNLCAGDGFADIIGRRFGKKKIPYNTDKSYAGTIAMASAGFIASVGYMYYFSIFGFVENSFEMVVGFLVASLTSALVESHPISTTLDDNLTVPLASLLAGILRNKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G047270`
TK1151 ID	TkA05G047270
OH-1004 ID	LXL04_019370
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.394 / OH-1004 98.790 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G047270

Location Chr05:12461739-12471425 (-)

Description Similar to Probable phytol kinase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58560`	Kinase involved in negative regulation of abscisic acid (ABA) signaling.	Farnesol kinase is involved in farnesol metabolism, ABA signaling and flower development in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04572.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0832000`	Involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019370 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006720 isoprenoid metabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0016487 farnesol metabolic process Biological Process

GO:0048440 carpel development Biological Process

GO:0009507 chloroplast Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0010276 phytol kinase activity Molecular Function

GO:0016301 kinase activity Molecular Function

GO:0052673 prenol kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G58560

gmx:100788252

gmx:100793696

zma:732748

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.722

Rank 1 · TkA05G047270 · TK1151

Mitochondrion0.108

Rank 2 · TkA05G047270 · TK1151

Cytoplasm0.106

Rank 3 · TkA05G047270 · TK1151

Nucleus0.103

Rank 4 · TkA05G047270 · TK1151

Golgi apparatus0.078

Rank 5 · TkA05G047270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14126DUF429353-107 aa

PF02313Fumarate_red_D63-108 aa

PF02313Fumarate_red_D178-220 aa

PF23858DUF7220199-246 aa

PF14126DUF4293203-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G047270	`PF14126`	DUF4293	53	107	0.018	15.9
TkA05G047270	`PF02313`	Fumarate_red_D	63	108	0.13	13.2
TkA05G047270	`PF02313`	Fumarate_red_D	178	220	0.13	13.2
TkA05G047270	`PF23858`	DUF7220	199	246	0.12	13.4
TkA05G047270	`PF14126`	DUF4293	203	203	0.018	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67ZM7`	Arabidopsis thaliana	sp\|Q67ZM7\|FOLK_ARATH Farnesol kinase, chloroplastic	62.400%	Swiss-Prot	High
`Q5N9J9`	Oryza sativa subsp. japonica	sp\|Q5N9J9\|PHYK2_ORYSJ Probable phytol kinase 2, chloroplastic	67.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card