TkA05G044590 | RubberDandelionOmics

Gene overview

TkA05G044590

Reference: TK1151 Chr: Chr05 Coordinates: 11798238-11799437 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · TkA05G044590|TK1151|cDNA

ATGTATTATACGCTACGCTCGGAAACATTAAAAGGAATCGGAAAATCCCGGATTTGGGAATCCGGCAAGAACCGTACCCACGTTTTGGAAACGGGTCAAAGGGCACATCCTATGCTAACCGAAAACGAACGTAAAAGAGTATGCAAATTCATAGACTGCGAGAAGCTATCTCAAGAAGCATCAAACCACGCGGCCCAAAACGACCGTCTGCCCGCCCACATGGCGGTTCGGGTCCTCTACTTTGAACAACTCAGGCTAAG...

CDS

Download CDS FASTA

579 bp · TkA05G044590|TK1151|CDS

ATGTATTATACGCTACGCTCGGAAACATTAAAAGGAATCGGAAAATCCCGGATTTGGGAATCCGGCAAGAACCGTACCCACGTTTTGGAAACGGGTCAAAGGGCACATCCTATGCTAACCGAAAACGAACGTAAAAGAGTATGCAAATTCATAGACTGCGAGAAGCTATCTCAAGAAGCATCAAACCACGCGGCCCAAAACGACCGTCTGCCCGCCCACATGGCGGTTCGGGTCCTCTACTTTGAACAACTCAGGCTAAG...

Protein

Download Protein FASTA

192 aa · TkA05G044590|TK1151|PROTEIN

MYYTLRSETLKGIGKSRIWESGKNRTHVLETGQRAHPMLTENERKRVCKFIDCEKLSQEASNHAAQNDRLPAHMAVRVLYFEQLRLRTAITGPSAFSGYMSGAPSGAPSAAMSPRDTYASLRRENRDLKLEISRMRVRLSDLEKEQVCMKQGMMDKSGNGKTFLTSISKIFAGPMSGKQHKSRSRRRGYSIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G044590`
TK1151 ID	TkA05G044590
OH-1004 ID	LXL04_019340
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.300
Protein coverage (%)	TK1151 82.812 / OH-1004 24.499 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G044590

Location Chr05:11798238-11799437 (-)

Description Similar to At3g08570: BTB/POZ domain-containing protein At3g08570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08660`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g08570`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g03010`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g47860`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g48800`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019340 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G03010

ath:AT2G47860

ath:AT3G08570

ath:AT3G08660

ath:AT5G48800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.472

Rank 1 · TkA05G044590 · TK1151

Nucleus0.410

Rank 2 · TkA05G044590 · TK1151

Cell membrane0.114

Rank 3 · TkA05G044590 · TK1151

Mitochondrion0.103

Rank 4 · TkA05G044590 · TK1151

Endoplasmic reticulum0.044

Rank 5 · TkA05G044590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03000NPH335-61 aa

PF29075NOCA1_mid51-75 aa

PF09755DUF2046115-152 aa

PF26052BRE1B117-148 aa

PF07989Cnn_1N119-147 aa

PF07558Shugoshin_N119-149 aa

PF29075NOCA1_mid120-155 aa

PF30981CCDC162_C124-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G044590	`PF03000`	NPH3	35	61	6e-08	33.4
TkA05G044590	`PF29075`	NOCA1_mid	51	75	0.027	15.0
TkA05G044590	`PF09755`	DUF2046	115	152	0.05	13.5
TkA05G044590	`PF26052`	BRE1B	117	148	0.022	15.3
TkA05G044590	`PF07989`	Cnn_1N	119	147	0.02	15.8
TkA05G044590	`PF07558`	Shugoshin_N	119	149	0.047	14.2
TkA05G044590	`PF29075`	NOCA1_mid	120	155	0.027	15.0
TkA05G044590	`PF30981`	CCDC162_C	124	155	0.069	13.3
TkA05G044590	`PF03000`	NPH3	139	148	6e-08	33.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9Z0`	Arabidopsis thaliana	sp\|Q9C9Z0\|Y3866_ARATH Putative BTB/POZ domain-containing protein At3g08660	61.300%	Swiss-Prot	High
`Q9C9Z7`	Arabidopsis thaliana	sp\|Q9C9Z7\|Y3857_ARATH BTB/POZ domain-containing protein At3g08570	55.200%	Swiss-Prot	High
`Q9SA69`	Arabidopsis thaliana	sp\|Q9SA69\|Y1301_ARATH BTB/POZ domain-containing protein At1g03010	48.600%	Swiss-Prot	Medium
`O82253`	Arabidopsis thaliana	sp\|O82253\|SETH6_ARATH BTB/POZ domain-containing protein SETH6	42.100%	Swiss-Prot	Medium
`Q9FKB6`	Arabidopsis thaliana	sp\|Q9FKB6\|Y5880_ARATH BTB/POZ domain-containing protein At5g48800	45.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card