LXL04_019340 | RubberDandelionOmics

Gene overview

LXL04_019340

Reference: OH-1004 Chr: Chr04 Coordinates: 29280114-29284241 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1950 bp · LXL04_019340|LXL04_019340|OH1004|cDNA

ATGGCCTCAAAAGTATTCAACATGGGAGACTCCATAAAGTTTACAAATATGATATCTCTGCCGTTACTGTTGAAACAACTAGACGGCTACACATCTTTAGTCGGAAGTGCTTCCGGTGGAGTGGTGGCGGTGATCATTTTCTGCATTCTTAGCCAACCGGCTGCTGGTGGTGGTACGACGATGGTACTATCCGACCACAATAACCGCTCCTCGCCTAGTCCCAGGTTCTGCAACTCCTTCGCTAATCGTATCTTTTCAGA...

CDS

Download CDS FASTA

1950 bp · LXL04_019340|LXL04_019340|OH1004|CDS

ATGGCCTCAAAAGTATTCAACATGGGAGACTCCATAAAGTTTACAAATATGATATCTCTGCCGTTACTGTTGAAACAACTAGACGGCTACACATCTTTAGTCGGAAGTGCTTCCGGTGGAGTGGTGGCGGTGATCATTTTCTGCATTCTTAGCCAACCGGCTGCTGGTGGTGGTACGACGATGGTACTATCCGACCACAATAACCGCTCCTCGCCTAGTCCCAGGTTCTGCAACTCCTTCGCTAATCGTATCTTTTCAGA...

Protein

Download Protein FASTA

649 aa · LXL04_019340|LXL04_019340|OH1004|PROTEIN

MASKVFNMGDSIKFTNMISLPLLLKQLDGYTSLVGSASGGVVAVIIFCILSQPAAGGGTTMVLSDHNNRSSPSPRFCNSFANRIFSDVAGDITITIDDTSFLLHKFPLVSQSGKIRKMVAETKDTNLSKLDLINFPGGPEAFELAAKFCYGVNFEITPANVAHLHCAASYLEMTENYRNENLIARTQSYLDDIVSQNLEKSIQVLRSCDTILPIADDLGITNKLVEFIADNACKEQLVAGLSRLECDNQIVDEKGRLQDW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019340`
TK1151 ID	TkA05G044590
OH-1004 ID	LXL04_019340
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.300
Protein coverage (%)	TK1151 82.812 / OH-1004 24.499 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019340

Location Chr04:29280114-29284241 (-)

Description Similar to At3g08570: BTB/POZ domain-containing protein At3g08570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08570`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g08660`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g48800`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g03010`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g47860`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019340 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G03010

ath:AT2G47860

ath:AT3G08570

ath:AT3G08660

ath:AT5G48800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.482

Rank 1 · LXL04_019340 · OH-1004

Cytoplasm0.310

Rank 2 · LXL04_019340 · OH-1004

Cell membrane0.184

Rank 3 · LXL04_019340 · OH-1004

Plastid0.059

Rank 4 · LXL04_019340 · OH-1004

Endoplasmic reticulum0.058

Rank 5 · LXL04_019340 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03000.20NPH3259-518 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019340	`PF03000.20`	NPH3	259	518	5.9e-84	282.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9Z7`	Arabidopsis thaliana	BTB/POZ domain-containing protein At3g08570	56.997%	Swiss-Prot	strong database homology
`Q9C9Z0`	Arabidopsis thaliana	Putative BTB/POZ domain-containing protein At3g08660	54.329%	Swiss-Prot	strong database homology
`Q9FKB6`	Arabidopsis thaliana	BTB/POZ domain-containing protein At5g48800	48.325%	Swiss-Prot	moderate database homology
`Q9SA69`	Arabidopsis thaliana	BTB/POZ domain-containing protein At1g03010	44.209%	Swiss-Prot	moderate database homology
`O82253`	Arabidopsis thaliana	BTB/POZ domain-containing protein SETH6	44.221%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card