TkA05G040430 | RubberDandelionOmics

Gene overview

TkA05G040430

Reference: TK1151 Chr: Chr05 Coordinates: 10862801-10866375 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2264 bp · TkA05G040430|TK1151|cDNA

ATTTTGTAAAATACATTTTTTTGTCAAAATACTTCCTCCAAAGTAAACGTTATCCTATCGACCCTGCCCTGGAGTGTTGGTTTCAGTTGGGCTTTCTCTCGGCGATTTTGGATACTCGGAACAAGCGGTTGAAATTTTGGTCGATTTTGGCGTTAAATCACAACTCTTAATTCAATGCTTCTCAAAGCATCACCGCCGGCGTTACCTATAAATTTCAAATTTAGCTTCAACACCGTCTCAAACTCGACATTACCTTCTTT...

CDS

Download CDS FASTA

1875 bp · TkA05G040430|TK1151|CDS

ATGCTTCTCAAAGCATCACCGCCGGCGTTACCTATAAATTTCAAATTTAGCTTCAACACCGTCTCAAACTCGACATTACCTTCTTTCTGCAATTGCGGTGTTTCCGGCGAATTTGGGGTCGGTGGCACGAAATCTGGAAGAAGAGGGATAGTAGCGGTCGGAGCAGGATATACTAAGAGGCCACTGGAAACTCCAGGAGCGTATGAGCTTGTTGACGAGGAGAGTGGGGATAAGTTTATCGTTTGGGGAGGAACTGATGA...

Protein

Download Protein FASTA

624 aa · TkA05G040430|TK1151|PROTEIN

MLLKASPPALPINFKFSFNTVSNSTLPSFCNCGVSGEFGVGGTKSGRRGIVAVGAGYTKRPLETPGAYELVDEESGDKFIVWGGTDDDDYQAPIPSKDVLHWEPSKKNNKDNINNLETNSTEGARMNNSDDGTTRPKVSSKGVKVSRSFDRLRAVKVRDPIRVSSSLKKDQHDNVQEETLSTKQNRSKSLKDDDVSKLDRELEAPSMNVSNKLRKSNAASDFFSRKSFKTLGCTDYMLQFLNSQLLAYPSHIQAMSFPHV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G040430`
TK1151 ID	TkA05G040430
OH-1004 ID	LXL04_019314
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G040430

Location Chr05:10862801-10866375 (-)

Description Similar to Os03g0108600: DEAD-box ATP-dependent RNA helicase 50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06980`	Probably involved in resistance to biotic and abiotic stresses.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0108600`	Probably involved in resistance to biotic and abiotic stresses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019314 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006968 cellular defense response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0071395 cellular response to jasmonic acid stimulus Biological Process

GO:0071446 cellular response to salicylic acid stimulus Biological Process

GO:0110102 ribulose bisphosphate carboxylase complex assembly Biological Process

GO:1901259 chloroplast rRNA processing Biological Process

GO:1902775 mitochondrial large ribosomal subunit assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G06980

ath:AT4G09730

dosa:Os01g0184500

dosa:Os03g0108600

ecu:ECU08_1080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.925

Rank 1 · TkA05G040430 · TK1151

Nucleus0.055

Rank 2 · TkA05G040430 · TK1151

Mitochondrion0.052

Rank 3 · TkA05G040430 · TK1151

Cytoplasm0.025

Rank 4 · TkA05G040430 · TK1151

Peroxisome0.014

Rank 5 · TkA05G040430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00176SNF2-rel_dom250-386 aa

PF00270DEAD251-421 aa

PF04851ResIII264-362 aa

PF00271Helicase_C302-361 aa

PF00271Helicase_C474-584 aa

PF13307Helicase_C_2487-559 aa

PF00270DEAD488-523 aa

PF22590Cas3-like_C_2489-584 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G040430	`PF00176`	SNF2-rel_dom	250	386	0.046	13.5
TkA05G040430	`PF00270`	DEAD	251	421	5.8e-34	118.0
TkA05G040430	`PF04851`	ResIII	264	362	0.003	18.2
TkA05G040430	`PF00271`	Helicase_C	302	361	9.6e-25	87.7
TkA05G040430	`PF00271`	Helicase_C	474	584	9.6e-25	87.7
TkA05G040430	`PF13307`	Helicase_C_2	487	559	0.15	12.8
TkA05G040430	`PF00270`	DEAD	488	523	5.8e-34	118.0
TkA05G040430	`PF22590`	Cas3-like_C_2	489	584	0.021	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUG7`	Arabidopsis thaliana	sp\|Q8GUG7\|RH50_ARATH DEAD-box ATP-dependent RNA helicase 50	68.300%	Swiss-Prot	Medium
`Q0DVX2`	Oryza sativa subsp. japonica	sp\|Q0DVX2\|RH50_ORYSJ DEAD-box ATP-dependent RNA helicase 50	53.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card