LXL04_019314 | RubberDandelionOmics

Gene overview

LXL04_019314

Reference: OH-1004 Chr: Chr04 Coordinates: 28692388-28695608 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1875 bp · LXL04_019314|LXL04_019314|OH1004|cDNA

ATGCTTCTCAAAGCATCACCGCCGGCGTTACCTATAAATTTCAAATTTAGCTTCAACACCGTCTCAAACTCGACATTACCTTCTTTCTGCAATTGCGGTGTTTCCGGCGAATTTGGGGTCGGTGGCACGAAATCTGGAAGAAGAGGGATAGTAGCGGTCGGAGCAGGATATACTAAGAGGCCACTGGAAACTCCAGGAGCGTATGAGCTTGTTGACGAGGACAGTGGGGATAAGTTTATCGTTTGGGGAGGAACTGATGA...

CDS

Download CDS FASTA

1875 bp · LXL04_019314|LXL04_019314|OH1004|CDS

ATGCTTCTCAAAGCATCACCGCCGGCGTTACCTATAAATTTCAAATTTAGCTTCAACACCGTCTCAAACTCGACATTACCTTCTTTCTGCAATTGCGGTGTTTCCGGCGAATTTGGGGTCGGTGGCACGAAATCTGGAAGAAGAGGGATAGTAGCGGTCGGAGCAGGATATACTAAGAGGCCACTGGAAACTCCAGGAGCGTATGAGCTTGTTGACGAGGACAGTGGGGATAAGTTTATCGTTTGGGGAGGAACTGATGA...

Protein

Download Protein FASTA

624 aa · LXL04_019314|LXL04_019314|OH1004|PROTEIN

MLLKASPPALPINFKFSFNTVSNSTLPSFCNCGVSGEFGVGGTKSGRRGIVAVGAGYTKRPLETPGAYELVDEDSGDKFIVWGGTDDDDYQAPIPSKEVLHWEPSKKNNKDNINNLETNSTEGARMNNSDDGTTRPKVSSKGVKVSRSFDRLRAVKVRDPIRVSSSLEKDQHDNVQEETLSTKQNRSKSLKDDDVSKLDRELEAPSMNVSNKLRKSNAASDFFSRKSFKTLGCTDYMLQFLNSQLLAYPSHIQAMSFPHV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019314`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019314

Location Chr04:28692388-28695608 (-)

Description Similar to Os03g0108600: DEAD-box ATP-dependent RNA helicase 50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06980`	Probably involved in resistance to biotic and abiotic stresses.	No verified direct reference in this release
`At4g09730`	DEAD-box ATP-dependent RNA helicase 39.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0108600`	Probably involved in resistance to biotic and abiotic stresses.	No verified direct reference in this release
`Os01g0184500`	DEAD-box ATP-dependent RNA helicase 39.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019314 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006968 cellular defense response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0071395 cellular response to jasmonic acid stimulus Biological Process

GO:0071446 cellular response to salicylic acid stimulus Biological Process

GO:0110102 ribulose bisphosphate carboxylase complex assembly Biological Process

GO:1901259 chloroplast rRNA processing Biological Process

GO:1902775 mitochondrial large ribosomal subunit assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G06980

ath:AT4G09730

dosa:Os01g0184500

dosa:Os03g0108600

ecu:ECU08_1080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.925

Rank 1 · LXL04_019314 · OH-1004

Nucleus0.056

Rank 2 · LXL04_019314 · OH-1004

Mitochondrion0.052

Rank 3 · LXL04_019314 · OH-1004

Cytoplasm0.025

Rank 4 · LXL04_019314 · OH-1004

Peroxisome0.013

Rank 5 · LXL04_019314 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD251-421 aa

PF00271.38Helicase_C474-584 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019314	`PF00270.36`	DEAD	251	421	5.8e-34	118.0
LXL04_019314	`PF00271.38`	Helicase_C	474	584	9.8e-25	87.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUG7`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 50	68.281%	Swiss-Prot	moderate database homology
`Q56X76`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 39	33.333%	Swiss-Prot	moderate database homology
`Q0DVX2`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 50	53.420%	Swiss-Prot	strong database homology
`Q5VRY0`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 39	32.763%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card