Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1741 bp · TkA05G038920|TK1151|cDNA
CTGAATTCGTAGGAAAAAACAAATGTCGTTGTCATAAAGAAGCCTAATTGGCCAATATTGAAGAGGTTAAGTTGAGGGGCACTTCTACAAATCATGCGCTTAACGGGAGTACGGGATAAACGGAAAACCAAACCCTAATTCAAAAATCCAGTCGATTAAATGAAAGAAGATCCCTCAGAGTGTAAGATTCGTAATTTCATAAAATGGACATTGATCTAGGTAGGTGGATTCTCGAGTTCCTCATCCGACAACATTCACTC...
1161 bp · TkA05G038920|TK1151|CDS
ATGGACATTGATCTAGGTAGGTGGATTCTCGAGTTCCTCATCCGACAACATTCACTCGATGATCGTTTACTAAACACTCTAATTCGCGTTCTTCCATCGTCAAACAACGACACAAGCATCCAAAAAAGCTTGCTCTTGCGAAAACTGGAGTCTGATATCGAGAAAGGTACAATCTCCGAACGCACTCTCGAATTCTTTGAACAAATTGAAGAACTGGATCACCGAGAAGGAAACACTGAGGTTTCCGAAGCCATGAAATC...
Protein
Download Protein FASTA386 aa · TkA05G038920|TK1151|PROTEIN
MDIDLGRWILEFLIRQHSLDDRLLNTLIRVLPSSNNDTSIQKSLLLRKLESDIEKGTISERTLEFFEQIEELDHREGNTEVSEAMKSAYCAVAVHCTVKIIKESEDDDQLKYFSAVRTIWRSRIREMEKFDVANRVGLISDNLLVWMDDLEAGVWVSNYFDKILVKYKELDALKAVCGYVTEAKEKMGPTFLELVAETLGDDISREVLDLGKDEEHHDHDQIKEMAANDAPNDDQCVDANLNSEDNGVHDRVDVDDPNPS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G038920 |
|---|---|
| TK1151 ID | TkA05G038920 |
| OH-1004 ID | LXL04_019299 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G038920 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:10536841-10538942 (+) | |||||||||
| Description | Similar to TRB3: Telomere repeat-binding factor 3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000723 telomere maintenance Biological Process GO:0006278 RNA-templated DNA biosynthetic process Biological Process GO:0006334 nucleosome assembly Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0016233 telomere capping Biological Process GO:0031627 telomeric loop formation Biological Process GO:0031848 protection from non-homologous end joining at telomere Biological Process GO:0032204 regulation of telomere maintenance Biological Process GO:0032205 negative regulation of telomere maintenance Biological Process GO:0032206 positive regulation of telomere maintenance Biological Process GO:0032208 negative regulation of telomere maintenance via recombination Biological Process GO:0032210 regulation of telomere maintenance via telomerase Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G49850 hsa:7014 zma:542123 zma:542124 zma:542125 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF18587PLL305-370 aaPF00249Myb_DNA-binding335-384 aaPF23588HTH_CHD1_Hrp3336-361 aaPF13921Myb_DNA-bind_6338-384 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G038920 | PF18587 | PLL | 305 | 370 | 0.24 | 12.3 |
| TkA05G038920 | PF00249 | Myb_DNA-binding | 335 | 384 | 9.4e-09 | 36.0 |
| TkA05G038920 | PF23588 | HTH_CHD1_Hrp3 | 336 | 361 | 0.0091 | 16.7 |
| TkA05G038920 | PF13921 | Myb_DNA-bind_6 | 338 | 384 | 8e-06 | 26.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.