LXL04_019299 | RubberDandelionOmics

Gene overview

LXL04_019299

Reference: OH-1004 Chr: Chr04 Coordinates: 28354294-28355895 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1158 bp · LXL04_019299|LXL04_019299|OH1004|cDNA

ATGGACATTGATCTAGGTAGGTGGATTCTCGAGTTCCTCATCCGACAACATTCACTCGATGATCGTTTACTAAACACTCTAATTCGCGTTCTTCCATCGTCAAACAACGACACAAGCATCCAAAAAAGCTTGCTCTTGCGAAAACTGGAGTCTGATATCGAGAAAGGTACAATCTCCGAACGCACTCTCGAATTCTTTGAACAAATTGAAGAACTGGATCACCGAGAAGGAAACACTGAGGTTTCCGAAGCCATGAAATC...

CDS

Download CDS FASTA

1158 bp · LXL04_019299|LXL04_019299|OH1004|CDS

ATGGACATTGATCTAGGTAGGTGGATTCTCGAGTTCCTCATCCGACAACATTCACTCGATGATCGTTTACTAAACACTCTAATTCGCGTTCTTCCATCGTCAAACAACGACACAAGCATCCAAAAAAGCTTGCTCTTGCGAAAACTGGAGTCTGATATCGAGAAAGGTACAATCTCCGAACGCACTCTCGAATTCTTTGAACAAATTGAAGAACTGGATCACCGAGAAGGAAACACTGAGGTTTCCGAAGCCATGAAATC...

Protein

Download Protein FASTA

385 aa · LXL04_019299|LXL04_019299|OH1004|PROTEIN

MDIDLGRWILEFLIRQHSLDDRLLNTLIRVLPSSNNDTSIQKSLLLRKLESDIEKGTISERTLEFFEQIEELDHREGNTEVSEAMKSAYCAVAVHCTVKIIKESEDDDQLKYFSAVRTIWRSRIREMEKFDVANRVGLISDNLLVWMDDLEAGVWVSNYFDKILVKYKELDALKAVCGYVTEAKEKMGPTFLELVAETLGDDISREVLDLGKDEEHHDQIKEMAANDAPNDDQCVDANLNSEDNGVHDRVDVDDPNPSFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019299`
TK1151 ID	TkA05G038920
OH-1004 ID	LXL04_019299
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019299

Location Chr04:28354294-28355895 (+)

Description Similar to TRB3: Telomere repeat-binding factor 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49850`	Binds preferentially double-stranded telomeric repeats, but it can also bind to the single G-rich telomeric strand.	Single-Myb-histone proteins from Arabidopsis thaliana: a quantitative study of telomere-binding specificity and kinetics.2009 · DOI: 10.1042/bj20082195

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019299 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006278 RNA-templated DNA biosynthetic process Biological Process

GO:0006334 nucleosome assembly Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0016233 telomere capping Biological Process

GO:0031627 telomeric loop formation Biological Process

GO:0031848 protection from non-homologous end joining at telomere Biological Process

GO:0032204 regulation of telomere maintenance Biological Process

GO:0032205 negative regulation of telomere maintenance Biological Process

GO:0032206 positive regulation of telomere maintenance Biological Process

GO:0032208 negative regulation of telomere maintenance via recombination Biological Process

GO:0032210 regulation of telomere maintenance via telomerase Biological Process

KEGG gene cross-reference

ath:AT3G49850

hsa:7014

zma:542123

zma:542124

zma:542125

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · LXL04_019299 · OH-1004

Cytoplasm0.092

Rank 2 · LXL04_019299 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_019299 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_019299 · OH-1004

Plastid0.011

Rank 5 · LXL04_019299 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding334-383 aa

PF13921.13Myb_DNA-bind_6337-383 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019299	`PF00249.38`	Myb_DNA-binding	334	383	1.1e-08	35.7
LXL04_019299	`PF13921.13`	Myb_DNA-bind_6	337	383	6e-06	27.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2X3`	Arabidopsis thaliana	Telomere repeat-binding factor 3	50.943%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card