TkA05G033720 | RubberDandelionOmics

Gene overview

TkA05G033720

Reference: TK1151 Chr: Chr05 Coordinates: 9128489-9131583 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2314 bp · TkA05G033720|TK1151|cDNA

TTCCCGTTGACTAAGACTCGAACGGTAACTCGTTATAAATAATCGAAATTATGTTCAAACAAAAAAAAAATCTGAATCCCGAAGTCTATTAATCCATTCATACATAATCGCCGAGATGAAGCAAACAGGTGTGCACTTACCCCCAATCGACGAACAGAAGCCCATAAGCCAGCAGCAGCAAAGCGAAATCAGCATTCCGGTTACTCACCCAAGACCACCACTACCGAAGCTACCGACCGCAGATCTTCTTACCGGAAGCA...

CDS

Download CDS FASTA

2040 bp · TkA05G033720|TK1151|CDS

ATGAAGCAAACAGGTGTGCACTTACCCCCAATCGACGAACAGAAGCCCATAAGCCAGCAGCAGCAAAGCGAAATCAGCATTCCGGTTACTCACCCAAGACCACCACTACCGAAGCTACCGACCGCAGATCTTCTTACCGGAAGCAGAGAAGTTTACATCGACATAGGTGTCCCTCTATATGAAGCCGCCATTAAAGGCGATTGGAAAGCTGCGGAAGCTATTCTTCTTAAAGAACCAAAATTGGTACGTTCCAGCATCAC...

Protein

Download Protein FASTA

679 aa · TkA05G033720|TK1151|PROTEIN

MKQTGVHLPPIDEQKPISQQQQSEISIPVTHPRPPLPKLPTADLLTGSREVYIDIGVPLYEAAIKGDWKAAEAILLKEPKLVRSSITENHETALHVAASAKRTKQVEEFVENLVKMMEEEDLELQNNSSNTALCLAAAAGNVEMVKIMAIKNKKLLTIPGSQAMMPLYMAALFGNHDMVKYLYDNSRKLSDDGWTHQNRGWLLLKCVESDLFDVALKIVTERPELASNGSVLGVLAKKPDAFIETKSNIIWRKLNSFFAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G033720`
TK1151 ID	TkA05G033720
OH-1004 ID	LXL04_019249
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 97.349 / OH-1004 51.084 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G033720`
Location	Chr05:9128489-9131583 (+)
Description	Similar to NPR4: Ankyrin repeat-containing protein NPR4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019249` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006929 substrate-dependent cell migration Biological Process GO:0009651 response to salt stress Biological Process GO:0048013 ephrin receptor signaling pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0046875 ephrin receptor binding Molecular Function
KEGG gene cross-reference	ath:AT3G12360 ath:AT5G02620 dosa:Os01g0837000 hsa:23294 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.896

Rank 1 · TkA05G033720 · TK1151

Cytoplasm0.077

Rank 2 · TkA05G033720 · TK1151

Endoplasmic reticulum0.063

Rank 3 · TkA05G033720 · TK1151

Nucleus0.031

Rank 4 · TkA05G033720 · TK1151

Lysosome / Vacuole0.023

Rank 5 · TkA05G033720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00023Ank58-75 aa

PF13606Ank_358-76 aa

PF12796Ank_259-151 aa

PF13637Ank_461-103 aa

PF13857Ank_588-102 aa

PF00023Ank90-114 aa

PF13606Ank_390-110 aa

PF13637Ank_494-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G033720	`PF00023`	Ank	58	75	7.9e-12	45.4
TkA05G033720	`PF13606`	Ank_3	58	76	3.8e-09	36.7
TkA05G033720	`PF12796`	Ank_2	59	151	1e-18	68.3
TkA05G033720	`PF13637`	Ank_4	61	103	9.9e-12	45.5
TkA05G033720	`PF13857`	Ank_5	88	102	5.1e-09	37.0
TkA05G033720	`PF00023`	Ank	90	114	7.9e-12	45.4
TkA05G033720	`PF13606`	Ank_3	90	110	3.8e-09	36.7
TkA05G033720	`PF13637`	Ank_4	94	147	9.9e-12	45.5
TkA05G033720	`PF12796`	Ank_2	108	185	1e-18	68.3
TkA05G033720	`PF13857`	Ank_5	120	149	5.1e-09	37.0
TkA05G033720	`PF00023`	Ank	130	147	7.9e-12	45.4
TkA05G033720	`PF13606`	Ank_3	130	148	3.8e-09	36.7
TkA05G033720	`PF13637`	Ank_4	134	182	9.9e-12	45.5
TkA05G033720	`PF12666`	PrgI	160	178	2.9	9.3
TkA05G033720	`PF13857`	Ank_5	162	184	5.1e-09	37.0
TkA05G033720	`PF00023`	Ank	166	183	7.9e-12	45.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card