TkA05G030290 | RubberDandelionOmics

Gene overview

TkA05G030290

Reference: TK1151 Chr: Chr05 Coordinates: 8199144-8202381 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1975 bp · TkA05G030290|TK1151|cDNA

GACAGTCTCCGCTTTAGCCACCTTCTGATCCTTTGCATACCGATATCTTTCATTTCCCTTCGATCCAAATTGCTGCGACGCCGGCGGTTGACCGGAAAACAGCAACACCAGTTTGGACGGGGGAGAGGCTCCTACTTCTTCTTCTGGTTTATCAACAGCTTCCAGTCATTCGTGCTTCGCCACAACTGAGAGTCAAAAGCCATGGATAGTGAAAAGGGAGACAAGTCTGCTGATGTCAACAATTCCACTGTAGATGTGAA...

CDS

Download CDS FASTA

1611 bp · TkA05G030290|TK1151|CDS

ATGGATAGTGAAAAGGGAGACAAGTCTGCTGATGTCAACAATTCCACTGTAGATGTGAAGCCAAAGAAGAAGTCTGGTGGAAAGAAAGAGAAGCCTGCCAATGCCAACAAACCTACTGCAAATGCGTCTTCTAATAAGGGAAAGAAGAAAGAGACTGGTCTAGGTCTCACTAACACTAAAGATGGCAACTTTGGGGAATGGTATTCTGAGGTTGTTGTAAATGGCGAAATGATAGAATATTATGAAATATCTGGCTGTTA...

Protein

Download Protein FASTA

536 aa · TkA05G030290|TK1151|PROTEIN

MDSEKGDKSADVNNSTVDVKPKKKSGGKKEKPANANKPTANASSNKGKKKETGLGLTNTKDGNFGEWYSEVVVNGEMIEYYEISGCYILRPWTMSIWEMMQTYFDAEIKKMKIKTCYFPLFVSNTVLQKEKDHIEGFAPEVAWVTRSGDSDLEVPIAIRPTSETVMYPYFSKWIRGHRDLPLKLNQWCNVVRWEFSNPTPFIRSREFLWQEGHTAFATKEEADTEVLEILELYRRLYEEYLAVPVVKGKKSEMEKFAGGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G030290`
TK1151 ID	TkA05G030290
OH-1004 ID	LXL04_019208
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G030290

Location Chr05:8199144-8202381 (+)

Description Similar to At3g62120: Proline--tRNA ligase, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62120`	Catalyzes the attachment of proline to tRNA(Pro) in a two-step reaction: proline is first activated by ATP to form Pro-AMP and then transferred to the acceptor end of tRNA(Pro).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019208 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006418 tRNA aminoacylation for protein translation Biological Process

GO:0006424 glutamyl-tRNA aminoacylation Biological Process

GO:0006433 prolyl-tRNA aminoacylation Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0032869 cellular response to insulin stimulus Biological Process

GO:0071346 cellular response to type II interferon Biological Process

GO:0140212 regulation of long-chain fatty acid import into cell Biological Process

GO:1901194 negative regulation of formation of translation preinitiation complex Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G62120

hsa:2058

mmu:107508

spo:2540431

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.819

Rank 1 · TkA05G030290 · TK1151

Nucleus0.229

Rank 2 · TkA05G030290 · TK1151

Mitochondrion0.086

Rank 3 · TkA05G030290 · TK1151

Cell membrane0.062

Rank 4 · TkA05G030290 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA05G030290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00587tRNA-synt_2b155-322 aa

PF03129HGTP_anticodon341-433 aa

PF23100DUF2096_N354-369 aa

PF23100DUF2096_N428-463 aa

PF00587tRNA-synt_2b445-474 aa

PF03129HGTP_anticodon450-470 aa

PF09180ProRS-C_1463-536 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G030290	`PF00587`	tRNA-synt_2b	155	322	3.7e-21	76.7
TkA05G030290	`PF03129`	HGTP_anticodon	341	433	1.5e-17	64.2
TkA05G030290	`PF23100`	DUF2096_N	354	369	0.22	12.7
TkA05G030290	`PF23100`	DUF2096_N	428	463	0.22	12.7
TkA05G030290	`PF00587`	tRNA-synt_2b	445	474	3.7e-21	76.7
TkA05G030290	`PF03129`	HGTP_anticodon	450	470	1.5e-17	64.2
TkA05G030290	`PF09180`	ProRS-C_1	463	536	1.3e-24	86.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1R2`	Arabidopsis thaliana	sp\|Q9M1R2\|SYPC_ARATH Proline--tRNA ligase, cytoplasmic	80.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card