TkA05G024800 | RubberDandelionOmics

Gene overview

TkA05G024800

Reference: TK1151 Chr: Chr05 Coordinates: 6720481-6730105 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1591 bp · TkA05G024800|TK1151|cDNA

AAATAATTCATTTAAATTTCGTTAAAGAATAAAAACAAACAATTAAGTACTGCAAGCAAAACAAGAGTAAGGGTTTATTCTGTTTATCGTTTCGGAGGTTAAGATTATAGTCCTAACTTTTACCTCATCTTCATCATACCAACAAACTTCCATTGCTGCTTCTGTTTACAAGTTTCAATTTCACTGTTAAACCCCAAATGGTTCCCAGAAACAACCAAGCAACGTTAACTTGGAAGAAAATTCCGGGTCTTGAACCCCTA...

CDS

Download CDS FASTA

2457 bp · TkA05G024800|TK1151|CDS

ATGGTTCCCAGAAACAACCAAGCAACGTTAACTTGGAAGAAAATTCCGGGTCTTGAACCCCTAAAATACGAAGAAAATGACCTCCTATGGCGTAGATGTGGTGGCAGCGGTGTCAATGGTGGCCCTGTTCGTTCTTATGGCATTGATTGTTTCGCTTCCGTTTCAATGACAGAGAATAAGAGAGTTGCAGCAACGATAGAACTCACACCCACGGCAGCGCAGCTTATGAAACACCCGCTGGCTATTGTGGCTTTGGTGCC...

Protein

Download Protein FASTA

818 aa · TkA05G024800|TK1151|PROTEIN

MVPRNNQATLTWKKIPGLEPLKYEENDLLWRRCGGSGVNGGPVRSYGIDCFASVSMTENKRVAATIELTPTAAQLMKHPLAIVALVPKEAAVFAAGAVAGAAAKTVTAPLDRIKLIMQTHGLRAGQETAKKSIGFIEAVVSIVKDEGVKGYWKGNLAQVLRILPYSAVQLFTYESYKKLFRGKDGELSVVGRLAAGASAGMTSTFVTYPLDVLRLRMAVDPGVKKSLPEKFRNKTEASLVTAFVAATIATVTCYPLDTIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G024800`
TK1151 ID	TkA05G024800
OH-1004 ID	LXL04_019164
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G024800

Location Chr05:6720481-6730105 (+)

Description Similar to RUS5: Protein root UVB sensitive 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01510`	Protein root UVB sensitive 5.	No verified direct reference in this release
`At5g01500`	Specifically transports adenine nucleotides.	Identification, expression, and functional analyses of a thylakoid ATP/ADP carrier from Arabidopsis.2007 · DOI: 10.1074/jbc.m609130200
`At3g51870`	Transports adenine nucleotides.	No verified direct reference in this release
`At3g45890`	Involved in a root UV-B sensing pathway and in the protection against the hypersensitivity to very low-fluence-rate (VLF) UV-B.	Role of root UV-B sensing in Arabidopsis early seedling development.2008 · DOI: 10.1073/pnas.0809942106 ROOT UV-B SENSITIVE2 acts with ROOT UV-B SENSITIVE1 in a root ultraviolet B-sensing pathway.2009 · DOI: 10.1104/pp.109.139253 ROOT ULTRAVIOLET B-SENSITIVE1/weak auxin response3 is essential for polar auxin transport in Arabidopsis.2013 · DOI: 10.1104/pp.113.217018
`At4g01100`	Mitochondrial adenylate carrier that catalyzes specifically the transport of ATP, ADP and AMP by a counter-exchange mechanism across the inner mitochondrial membrane.	Identification and characterization of ADNT1, a novel mitochondrial adenine nucleotide transporter from Arabidopsis.2008 · DOI: 10.1104/pp.108.130310

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019164 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006839 mitochondrial transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0010117 photoprotection Biological Process

GO:0010206 photosystem II repair Biological Process

GO:0015866 ADP transport Biological Process

GO:0015867 ATP transport Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0051503 adenine nucleotide transport Biological Process

GO:0071277 cellular response to calcium ion Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

KEGG gene cross-reference

ath:AT3G51870

ath:AT5G01500

ath:AT5G01510

mmu:229731

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.511

Rank 1 · TkA05G024800 · TK1151

Mitochondrion0.433

Rank 2 · TkA05G024800 · TK1151

Cytoplasm0.031

Rank 3 · TkA05G024800 · TK1151

Nucleus0.020

Rank 4 · TkA05G024800 · TK1151

Peroxisome0.017

Rank 5 · TkA05G024800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04884UVB_sens_prot62-101 aa

PF00153Mito_carr91-183 aa

PF18405SLC25_like91-153 aa

PF00153Mito_carr186-226 aa

PF18405SLC25_like191-212 aa

PF00153Mito_carr237-319 aa

PF18405SLC25_like240-344 aa

PF04884UVB_sens_prot448-668 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G024800	`PF04884`	UVB_sens_prot	62	101	1.2e-50	173.2
TkA05G024800	`PF00153`	Mito_carr	91	183	1.8e-57	191.8
TkA05G024800	`PF18405`	SLC25_like	91	153	0.072	12.9
TkA05G024800	`PF00153`	Mito_carr	186	226	1.8e-57	191.8
TkA05G024800	`PF18405`	SLC25_like	191	212	0.072	12.9
TkA05G024800	`PF00153`	Mito_carr	237	319	1.8e-57	191.8
TkA05G024800	`PF18405`	SLC25_like	240	344	0.072	12.9
TkA05G024800	`PF04884`	UVB_sens_prot	448	668	1.2e-50	173.2
TkA05G024800	`PF24160`	UVB_sens_C	673	809	1.1e-07	33.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B6IDH3`	Arabidopsis thaliana	sp\|B6IDH3\|RUS5_ARATH Protein root UVB sensitive 5	53.600%	Swiss-Prot	Medium
`Q9M024`	Arabidopsis thaliana	sp\|Q9M024\|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic	73.000%	Swiss-Prot	High
`O65023`	Arabidopsis thaliana	sp\|O65023\|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic	64.100%	Swiss-Prot	High
`Q7X6P3`	Arabidopsis thaliana	sp\|Q7X6P3\|RUS1_ARATH Protein root UVB sensitive 1, chloroplastic	27.000%	Swiss-Prot	Low
`O04619`	Arabidopsis thaliana	sp\|O04619\|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1	32.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card