LXL04_019164 | RubberDandelionOmics

Gene overview

LXL04_019164

Reference: OH-1004 Chr: Chr04 Coordinates: 25114581-25123408 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2649 bp · LXL04_019164|LXL04_019164|OH1004|cDNA

ATGGTTCCCAGAAACAACCAAGCAACGTTAACTTGGAAGAAAATTCCGGGTCTTGAACCCCTAAAATACGAAGAAAATGACCTCCTATGGCGTAGATGTGGTGGCAGCGGTGTCAATGGTGGCCCTGTTCGTTCTTATGGCATTGATTGTTTCGCTTCCGTTTCAATGACAGAGAATAAGAGAGTTGCAGCAACGATAGAACTCACACCCACGGCAGCGCAGCTTATGAAACACCCGCTGGCTATTGTGGCTTTGGTGCC...

CDS

Download CDS FASTA

2649 bp · LXL04_019164|LXL04_019164|OH1004|CDS

ATGGTTCCCAGAAACAACCAAGCAACGTTAACTTGGAAGAAAATTCCGGGTCTTGAACCCCTAAAATACGAAGAAAATGACCTCCTATGGCGTAGATGTGGTGGCAGCGGTGTCAATGGTGGCCCTGTTCGTTCTTATGGCATTGATTGTTTCGCTTCCGTTTCAATGACAGAGAATAAGAGAGTTGCAGCAACGATAGAACTCACACCCACGGCAGCGCAGCTTATGAAACACCCGCTGGCTATTGTGGCTTTGGTGCC...

Protein

Download Protein FASTA

882 aa · LXL04_019164|LXL04_019164|OH1004|PROTEIN

MVPRNNQATLTWKKIPGLEPLKYEENDLLWRRCGGSGVNGGPVRSYGIDCFASVSMTENKRVAATIELTPTAAQLMKHPLAIVALVPKEAAVFAAGAVAGAAAKTVTAPLDRIKLIMQTHGLRAGQETAKKSIGFIEAVVSIVKEEGVKGYWKGNLAQVLRILPYSAVQLFAYESYKKLFRGKDGELSVVGRLAAGASAGMTSTFVTYPLDVLRLRMAVDPGYQTMTNVVVRMLKEEGFGSFYRGLVPSLISIAPYVAVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019164`
TK1151 ID	TkA05G024800
OH-1004 ID	LXL04_019164
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019164

Location Chr04:25114581-25123408 (+)

Description Similar to RUS5: Protein root UVB sensitive 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01510`	Protein root UVB sensitive 5.	No verified direct reference in this release
`At3g51870`	Transports adenine nucleotides.	No verified direct reference in this release
`At5g01500`	Specifically transports adenine nucleotides.	Identification, expression, and functional analyses of a thylakoid ATP/ADP carrier from Arabidopsis.2007 · DOI: 10.1074/jbc.m609130200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019164 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006839 mitochondrial transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0010117 photoprotection Biological Process

GO:0010206 photosystem II repair Biological Process

GO:0015866 ADP transport Biological Process

GO:0015867 ATP transport Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0051503 adenine nucleotide transport Biological Process

GO:0071277 cellular response to calcium ion Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

KEGG gene cross-reference

ath:AT3G51870

ath:AT5G01500

ath:AT5G01510

mmu:229731

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.584

Rank 1 · LXL04_019164 · OH-1004

Mitochondrion0.348

Rank 2 · LXL04_019164 · OH-1004

Cytoplasm0.032

Rank 3 · LXL04_019164 · OH-1004

Peroxisome0.022

Rank 4 · LXL04_019164 · OH-1004

Nucleus0.020

Rank 5 · LXL04_019164 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr91-183 aa

PF00153.33Mito_carr186-273 aa

PF00153.33Mito_carr281-363 aa

PF04884.21UVB_sens_prot495-732 aa

PF24160.2UVB_sens_C737-873 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019164	`PF00153.33`	Mito_carr	91	183	6.7e-73	241.2
LXL04_019164	`PF00153.33`	Mito_carr	186	273	6.7e-73	241.2
LXL04_019164	`PF00153.33`	Mito_carr	281	363	6.7e-73	241.2
LXL04_019164	`PF04884.21`	UVB_sens_prot	495	732	1.1e-64	219.1
LXL04_019164	`PF24160.2`	UVB_sens_C	737	873	2.4e-07	31.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B6IDH3`	Arabidopsis thaliana	Protein root UVB sensitive 5	56.324%	Swiss-Prot	moderate database homology
`O65023`	Arabidopsis thaliana	Probable envelope ADP,ATP carrier protein, chloroplastic	63.990%	Swiss-Prot	weak database homology
`Q9M024`	Arabidopsis thaliana	Thylakoid ADP,ATP carrier protein, chloroplastic	73.394%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card