TkA05G023190 | RubberDandelionOmics

Gene overview

TkA05G023190

Reference: TK1151 Chr: Chr05 Coordinates: 6302232-6304775 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1432 bp · TkA05G023190|TK1151|cDNA

TTACAAATGAAAGCATAACTCCGTCACACAGCCGCCGCGAACACCGACTCCACCATTGCCTATGGCCGCCGTGCTATCAAAAACTGGTCACCTCCGTCGTGCTTACCGACTCTTATCTTACACTCGGTCAACACTTCAACTCTCCAATGAAATTCCCAAATCACCTCTCCACCGACCTCTTCCTCAATCGGACTTAGGATCATTTACAAAGCTCCCTAGGTTTCTATCTACCAATGCGAACGCGGCTGGCGGTGACGCTA...

CDS

Download CDS FASTA

597 bp · TkA05G023190|TK1151|CDS

ATGATCAGGAAAAGAAACGGCATATTGAAGGTAGATAACTACGACATAAATACTTCTTCAACTGCAGTAAAACAAGGACCTTCTGCTGGTAAAGCAGCCATTGGAGGTCCATTTAACCTTATTAACCATCATGGAAAATCTGTTACCGAAAATGATTTCAAAGGTAAATGGACCTTGATTTATTTCGGTTTCACCCACTGCCCGGATATCTGCCCGGACGAACTCCAAAAACTTGCTGCTGCAATCGATAAAATAAAGGT...

Protein

Download Protein FASTA

198 aa · TkA05G023190|TK1151|PROTEIN

MIRKRNGILKVDNYDINTSSTAVKQGPSAGKAAIGGPFNLINHHGKSVTENDFKGKWTLIYFGFTHCPDICPDELQKLAAAIDKIKVKSGIEIVPVFISVDPERDTVEQVGEYVKEFHPKLIGLTGDPEEVKKAARAYRVYYMKTEEEGSDYLVDHSIIMYLMDPNMEFIKFFGKNNDVDALTEGIINEIKNYKKAKQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G023190`
TK1151 ID	TkA05G023190
OH-1004 ID	LXL04_019147
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 92.929 / OH-1004 57.680 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G023190

Location Chr05:6302232-6304775 (-)

Description Similar to HCC1: Protein SCO1 homolog 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08950`	Acts as a copper chaperone, delivering copper to the Cu(A) site on the cytochrome c oxidase subunit II (COX2) (By similarity).	HCC1, the Arabidopsis homologue of the yeast mitochondrial copper chaperone SCO1, is essential for embryonic development.2011 · DOI: 10.1093/jxb/erq269

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019147 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006878 intracellular copper ion homeostasis Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0006955 immune response Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009306 protein secretion Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010467 gene expression Biological Process

GO:0010608 post-transcriptional regulation of gene expression Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0033617 mitochondrial respiratory chain complex IV assembly Biological Process

GO:0035264 multicellular organism growth Biological Process

KEGG gene cross-reference

ath:AT3G08950

bta:508586

hsa:6341

mmu:52892

spo:2539826

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.404

Rank 1 · TkA05G023190 · TK1151

Endoplasmic reticulum0.400

Rank 2 · TkA05G023190 · TK1151

Cytoplasm0.214

Rank 3 · TkA05G023190 · TK1151

Cell membrane0.113

Rank 4 · TkA05G023190 · TK1151

Nucleus0.092

Rank 5 · TkA05G023190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02630SCO1-SenC29-188 aa

PF00578AhpC-TSA38-145 aa

PF08534Redoxin38-149 aa

PF13905Thioredoxin_855-138 aa

PF27602HTH_ENOX191-121 aa

PF01320Colicin_Pyocin97-118 aa

PF01320Colicin_Pyocin173-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G023190	`PF02630`	SCO1-SenC	29	188	1.5e-60	204.4
TkA05G023190	`PF00578`	AhpC-TSA	38	145	2.4e-08	34.7
TkA05G023190	`PF08534`	Redoxin	38	149	0.0011	19.5
TkA05G023190	`PF13905`	Thioredoxin_8	55	138	0.00089	20.3
TkA05G023190	`PF27602`	HTH_ENOX1	91	121	0.1	13.1
TkA05G023190	`PF01320`	Colicin_Pyocin	97	118	0.19	12.5
TkA05G023190	`PF01320`	Colicin_Pyocin	173	195	0.19	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYP0`	Arabidopsis thaliana	sp\|Q8VYP0\|SCO11_ARATH Cytochrome c oxidase assembly factor HCC1	75.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card