Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2099 bp · TkA05G022320|TK1151|cDNA
CGGAACCCTCTGGAGCCCTCTTCTTAATTACGAAGCTATAAGTTGTAACGCGAACACACTCGATAACTAAAACATCAAAATCTTTTTGGTGAAATTTAGCGCTCTTGATTCTATTGTGAACGCAAAAACATTCCTGGGGATTTAGATTCGATCATTTTGAGAAAAATATGAAGAACAATCGTATCATATCGTCGATATGCATATTCTTTACATGTTCTTTGTTGCTATTCATCTCCGTAGAATCAAAATCTGTCGACCCT...
1716 bp · TkA05G022320|TK1151|CDS
ATGAAGAACAATCGTATCATATCGTCGATATGCATATTCTTTACATGTTCTTTGTTGCTATTCATCTCCGTAGAATCAAAATCTGTCGACCCTTATAAGGTACTAGGAGTAGAAAAGGATGCAAGTCCAAGGCAAATTCAGAAAGCTTTCCATAAGCTCTCTCTTCAATATCATCCCGATAAGAACAAAAACAAAGGTGCTCAGGAGAAGTTTGCTGAGATAAACAACGCATATGAAATCTTGTCGGATGAAGAAAAGAG...
Protein
Download Protein FASTA571 aa · TkA05G022320|TK1151|PROTEIN
MKNNRIISSICIFFTCSLLLFISVESKSVDPYKVLGVEKDASPRQIQKAFHKLSLQYHPDKNKNKGAQEKFAEINNAYEILSDEEKRKNYDMYGDARGNPGFDGGDHGGRTYFRSSGPGQGGGGGFTFSPDEWQTMGGHSGGSKSFSFSFGGSGGGLDADDVFSSFFGGGGMGGGSQFGGFGNSRPTRGNSPKNMVSINSQSYKKEVTDKGVTWIILSYTPSIKGVQHYESIIEEVGNSLKGALEVGSVNCEVELSLCKS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G022320 |
|---|---|
| TK1151 ID | TkA05G022320 |
| OH-1004 ID | LXL04_019138 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G022320 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:6054501-6058910 (-) | ||||||||||||
| Description | Similar to ERDJ3A: DnaJ protein ERDJ3A | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006260 DNA replication Biological Process GO:0009408 response to heat Biological Process GO:0009860 pollen tube growth Biological Process GO:0016243 regulation of autophagosome size Biological Process GO:0034605 cellular response to heat Biological Process GO:0042026 protein refolding Biological Process GO:0005737 cytoplasm Cellular Component GO:0005773 vacuole Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005788 endoplasmic reticulum lumen Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0009506 plasmodesma Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT3G08970 dosa:Os03g0293000 mmu:214063 mpe:MYPE8970 rno:362652 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00226DnaJ30-91 aaPF30912TIM141_C33-87 aaPF10145PhageMin_Tail43-87 aaPF13848Thioredoxin_6195-302 aaPF00085Thioredoxin196-301 aaPF26967A6-like_Thioredoxin-like_C328-390 aaPF00085Thioredoxin346-400 aaPF13848Thioredoxin_6349-380 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G022320 | PF00226 | DnaJ | 30 | 91 | 1e-26 | 93.5 |
| TkA05G022320 | PF30912 | TIM141_C | 33 | 87 | 0.13 | 13.0 |
| TkA05G022320 | PF10145 | PhageMin_Tail | 43 | 87 | 0.19 | 12.3 |
| TkA05G022320 | PF13848 | Thioredoxin_6 | 195 | 302 | 2.2e-07 | 31.6 |
| TkA05G022320 | PF00085 | Thioredoxin | 196 | 301 | 0.019 | 15.7 |
| TkA05G022320 | PF26967 | A6-like_Thioredoxin-like_C | 328 | 390 | 0.085 | 13.5 |
| TkA05G022320 | PF00085 | Thioredoxin | 346 | 400 | 0.019 | 15.7 |
| TkA05G022320 | PF13848 | Thioredoxin_6 | 349 | 380 | 2.2e-07 | 31.6 |
| TkA05G022320 | PF10145 | PhageMin_Tail | 386 | 426 | 0.19 | 12.3 |
| TkA05G022320 | PF13848 | Thioredoxin_6 | 435 | 551 | 2.2e-07 | 31.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.