LXL04_019138 | RubberDandelionOmics

Gene overview

LXL04_019138

Reference: OH-1004 Chr: Chr04 Coordinates: 24489364-24493960 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1719 bp · LXL04_019138|LXL04_019138|OH1004|cDNA

atgaagaacaatcGTATCATATCGTCGATATGCATATTCTTTACATGTTCTTTGTTGCTATTCATCTCCGTAGAATCAAAATCTGTCGACCCTTATAAGGTACTAGGAGTAGAAAAGGATGCAAGTCCAAGGCAAATTCAGAAAGCTTTCCATAAGCTCTCTCTTCAATATCATCCCGATAAGAACAAAAACAAAGGTGCTCAGGAGAAGTTTGCTGAGATAAACAACGCATATGAAATCTTGTCGgatgaagaaaagag...

CDS

Download CDS FASTA

1719 bp · LXL04_019138|LXL04_019138|OH1004|CDS

ATGAAGAACAATCGTATCATATCGTCGATATGCATATTCTTTACATGTTCTTTGTTGCTATTCATCTCCGTAGAATCAAAATCTGTCGACCCTTATAAGGTACTAGGAGTAGAAAAGGATGCAAGTCCAAGGCAAATTCAGAAAGCTTTCCATAAGCTCTCTCTTCAATATCATCCCGATAAGAACAAAAACAAAGGTGCTCAGGAGAAGTTTGCTGAGATAAACAACGCATATGAAATCTTGTCGGATGAAGAAAAGAG...

Protein

Download Protein FASTA

572 aa · LXL04_019138|LXL04_019138|OH1004|PROTEIN

MKNNRIISSICIFFTCSLLLFISVESKSVDPYKVLGVEKDASPRQIQKAFHKLSLQYHPDKNKNKGAQEKFAEINNAYEILSDEEKRKNYDMYGDARGNPGFDGGDHGGRTYFRSSGPGQGGGGGGFTFSPDEWQTMGGHSGGSKSFSFSFGGSGGGLDADDVFSSFFGGGGMGGGSQFGGFGNSRPTRGNSPKNMVSINSQSYKKEVTDKGVTWIILSYTPSIKGVQHYESIIEEVGNSLKGALEVGSVNCEVELSLCK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019138`
TK1151 ID	TkA05G022320
OH-1004 ID	LXL04_019138
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019138

Location Chr04:24489364-24493960 (-)

Description Similar to ERDJ3A: DnaJ protein ERDJ3A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08970`	Regulates protein folding in the endoplasmic reticulum (ER) lumen.	A mutation in Thermosensitive Male Sterile 1, encoding a heat shock protein with DnaJ and PDI domains, leads to thermosensitive gametophytic male sterility in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2008.03732.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0293000`	May play a role in protein folding in the endoplasmic reticulum.	Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.2013 · DOI: 10.1093/jxb/ert312

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019138 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0009408 response to heat Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0016243 regulation of autophagosome size Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G08970

dosa:Os03g0293000

mmu:214063

mpe:MYPE8970

rno:362652

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.787

Rank 1 · LXL04_019138 · OH-1004

Cytoplasm0.130

Rank 2 · LXL04_019138 · OH-1004

Nucleus0.110

Rank 3 · LXL04_019138 · OH-1004

Golgi apparatus0.070

Rank 4 · LXL04_019138 · OH-1004

Extracellular0.049

Rank 5 · LXL04_019138 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ30-91 aa

PF13848.13Thioredoxin_6196-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019138	`PF00226.37`	DnaJ	30	91	1.1e-26	93.4
LXL04_019138	`PF13848.13`	Thioredoxin_6	196	303	7.9e-08	33.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SR96`	Arabidopsis thaliana	DnaJ protein ERDJ3A	56.318%	Swiss-Prot	strong database homology
`Q10MW6`	Oryza sativa subsp. japonica	DnaJ protein ERDJ3A	52.801%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card