TkA05G014770 | RubberDandelionOmics

Gene overview

TkA05G014770

Reference: TK1151 Chr: Chr05 Coordinates: 4143571-4146899 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

771 bp · TkA05G014770|TK1151|cDNA

AGTATCATTTGCATAAACTTTACGAACTTCCTCAATTGTTTTGCTCTCACATTTTGGAGTTTTATAAATCGAACAACCTTTGTTATTTTCAATCTTTTATCTTAAGTTTTAGATGGATGCTTGGTCTGATGATGAAAGCGATTTCACAGAACAAATTGCCATGATGGCGATGACGGGAATGCAACGGGTCGTGCAGATTCTGCAAGAGGAAGAAGAAGAGGAAGGTGTCGTGAATTCGCAACCCAGGACACGACAGCCGA...

CDS

Download CDS FASTA

522 bp · TkA05G014770|TK1151|CDS

ATGGATGCTTGGTCTGATGATGAAAGCGATTTCACAGAACAAATTGCCATGATGGCGATGACGGGAATGCAACGGGTCGTGCAGATTCTGCAAGAGGAAGAAGAAGAGGAAGGTGTCGTGAATTCGCAACCCAGGACACGACAGCCGATTCCTAGAGACCGTGTGGGTGCTCACAACCGTCTGGTAGAACACTACTTCGCCCCCAATTGTGTTTACCCACCGTCTGTATTCCGTCGTCGTTTTCGAATGCGTAAACCTTT...

Protein

Download Protein FASTA

173 aa · TkA05G014770|TK1151|PROTEIN

MDAWSDDESDFTEQIAMMAMTGMQRVVQILQEEEEEEGVVNSQPRTRQPIPRDRVGAHNRLVEHYFAPNCVYPPSVFRRRFRMRKPLFLRILNDVTANSQFMQQRSDATGSQGFSELQKCVVAIRQLAYGSVSDSWDEYFQMSERTALESLDEFCSCIIQLYWGRCHRYLTIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G014770`
TK1151 ID	TkA05G014770
OH-1004 ID	LXL04_026467
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.700
Protein coverage (%)	TK1151 95.376 / OH-1004 11.474 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G014770`
Location	Chr05:4143571-4146899 (-)
Description	Similar to SALR: Salutaridine reductase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026467` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009820 alkaloid metabolic process Biological Process GO:0016104 triterpenoid biosynthetic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:0016020 membrane Cellular Component GO:0016491 oxidoreductase activity Molecular Function GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function GO:0047037 salutaridine reductase (NADPH) activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · TkA05G014770 · TK1151

Cytoplasm0.159

Rank 2 · TkA05G014770 · TK1151

Mitochondrion0.019

Rank 3 · TkA05G014770 · TK1151

Cell membrane0.013

Rank 4 · TkA05G014770 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA05G014770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26138DUF804020-30 aa

PF16517Nore1-SARAH25-37 aa

PF28509DUF841858-96 aa

PF26138DUF804076-158 aa

PF16517Nore1-SARAH88-94 aa

PF28509DUF8418136-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G014770	`PF26138`	DUF8040	20	30	0.35	11.5
TkA05G014770	`PF16517`	Nore1-SARAH	25	37	5.1	7.7
TkA05G014770	`PF28509`	DUF8418	58	96	6e-19	68.2
TkA05G014770	`PF26138`	DUF8040	76	158	0.35	11.5
TkA05G014770	`PF16517`	Nore1-SARAH	88	94	5.1	7.7
TkA05G014770	`PF28509`	DUF8418	136	141	6e-19	68.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card