TkA05G014450 | RubberDandelionOmics

Gene overview

TkA05G014450

Reference: TK1151 Chr: Chr05 Coordinates: 4068984-4080276 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1452 bp · TkA05G014450|TK1151|cDNA

ATGGTATGGTCGGTCAACTCCCAGCGGCAACACCATTTCGAGAGTTTACCGCTGGCGACCCTGGCGGTATGGGCGAAGCCAGCGGCTTTCTTTGCCAGCGGCAAAGTCCAACGGCTGGGGTACGCCGGTGTTTTTAAGATGGATAATTGGTCTTCTGATGAAAGCGATTTCACAGAACAAATTGCCATGATGGCGATGATGGGAATGCAACATGTCGTGCAGATTCTGCAAGACGAAGAAGAAGAGGAAGGTGTCGTGAA...

CDS

Download CDS FASTA

1452 bp · TkA05G014450|TK1151|CDS

ATGGTATGGTCGGTCAACTCCCAGCGGCAACACCATTTCGAGAGTTTACCGCTGGCGACCCTGGCGGTATGGGCGAAGCCAGCGGCTTTCTTTGCCAGCGGCAAAGTCCAACGGCTGGGGTACGCCGGTGTTTTTAAGATGGATAATTGGTCTTCTGATGAAAGCGATTTCACAGAACAAATTGCCATGATGGCGATGATGGGAATGCAACATGTCGTGCAGATTCTGCAAGACGAAGAAGAAGAGGAAGGTGTCGTGAA...

Protein

Download Protein FASTA

483 aa · TkA05G014450|TK1151|PROTEIN

MVWSVNSQRQHHFESLPLATLAVWAKPAAFFASGKVQRLGYAGVFKMDNWSSDESDFTEQIAMMAMMGMQHVVQILQDEEEEEGVVNSQPMTRQRIPRDRVGAHNRLVEHYFAPNCVYPPSVFLRRFRMRKPLFLRILNDVTANSQFMQQRSDATGSQGFSELQKCAVAIRQLAYGSVSDSWDEYFQMSERVALESLDEFCSCIISLYWGRYMRTPTPSDVQALYAHHSQHHGLPGMLGSLDCLHWEWDGCRVANHGQFT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G014450`
TK1151 ID	TkA05G014450
OH-1004 ID	LXL04_013205
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	80.000
Protein coverage (%)	TK1151 99.379 / OH-1004 81.801 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G014450

Location Chr05:4068984-4080276 (+)

Description Similar to At3g55350: Protein ALP1-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55350`	Transposase-derived protein that may have nuclease activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013205 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0000118 histone deacetylase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0035098 ESC/E(Z) complex Cellular Component

GO:0035102 PRC1 complex Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0004518 nuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G55350

ath:AT3G63270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.931

Rank 1 · TkA05G014450 · TK1151

Cytoplasm0.180

Rank 2 · TkA05G014450 · TK1151

Mitochondrion0.019

Rank 3 · TkA05G014450 · TK1151

Cell membrane0.018

Rank 4 · TkA05G014450 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA05G014450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28509DUF8418104-142 aa

PF04827Plant_tran211-413 aa

PF13359DDE_Tnp_4241-405 aa

PF01609DDE_Tnp_1350-402 aa

PF13586DDE_Tnp_1_2355-389 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G014450	`PF28509`	DUF8418	104	142	1.1e-17	64.2
TkA05G014450	`PF04827`	Plant_tran	211	413	2.2e-76	256.8
TkA05G014450	`PF13359`	DDE_Tnp_4	241	405	2.1e-14	54.2
TkA05G014450	`PF01609`	DDE_Tnp_1	350	402	0.022	15.2
TkA05G014450	`PF13586`	DDE_Tnp_1_2	355	389	0.22	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2U3`	Arabidopsis thaliana	sp\|Q9M2U3\|ALPL_ARATH Protein ALP1-like	25.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card