RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G007310
Reference: TK1151 Chr: Chr05 Coordinates: 2159886-2162988 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2350 bp · TkA05G007310|TK1151|cDNA

CCACCGTATTTTGTTCCAACCTGTTCTCCAATCTCACATGTATAATCTCCATCTTAATTCTTCAAACCCCTCAAATTTAATCCATTTTTTCCTCCCAATCACAGGAGAAATTCTCGCCGATATTACAAATCTAACGCCGTCTTTTTCTACATACTCTTTTCAAGATTTGTATAACGTGAGCACCGCCACCAGTAAGGAATATTGATTATGTCTTCTCCACCGCCGGGAGCTTCTCCGGCACCCACAACCCCAGCTACACC...

CDS

Download CDS FASTA

2037 bp · TkA05G007310|TK1151|CDS

ATGTCTTCTCCACCGCCGGGAGCTTCTCCGGCACCCACAACCCCAGCTACACCACCGCCCACTAACACCACTTCACCACCACCCGCTGCTTCTGCCCCACCTCCATCTACCCCTGCTTCTCCTCCACCCCCGACAACTCCTGTCTCTCCGCCTCCAGCTCCAACGCCACCAACCCCCGTCGCCCCAGTCACCCCTGTCGCTTCTCCCCCGCCTCCGGTTACTCCACCTCCCACCACTTCCCCTGCACCACCCACAGCCAC...

Protein

Download Protein FASTA

678 aa · TkA05G007310|TK1151|PROTEIN

MSSPPPGASPAPTTPATPPPTNTTSPPPAASAPPPSTPASPPPPTTPVSPPPAPTPPTPVAPVTPVASPPPPVTPPPTTSPAPPTATSPPPSTPTPTTPSPSPPSPPSPPGSTPSNRPPPAPRNSPPTTPGQTTPSPPPPRSVSSSPPAAPSSDNSSGISTGAVVGIAIGGVLLLAIFSILFICCKKKKRRTHDPAGFYVPPPPPPKVDPFGNHPQQWQHNAPPPGDHVVMMPPLKPPPMGTRPSQSPARSPSPQPPQRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G007310
TK1151 IDTkA05G007310
OH-1004 IDLXL04_018983
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G007310
LocationChr05:2159886-2162988 (-)
DescriptionSimilar to PERK1: Proline-rich receptor-like protein kinase PERK1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g24550 Proline-rich receptor-like protein kinase PERK1. No verified direct reference in this release
At2g18470 Required during abscisic acid (ABA)-mediated activation of Ca(2+) channels.
Plasma membrane-associated proline-rich extensin-like receptor kinase 4, a novel regulator of Ca signalling, is required for abscisic acid responses in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03956.x
Arabidopsis proline-rich extensin-like receptor kinase 4 modulates the early event toward abscisic acid response in root tip growth.2009 · DOI: 10.4161/psb.4.11.9739
At3g24400 Proline-rich receptor-like protein kinase PERK2. No verified direct reference in this release
At4g34440 Proline-rich receptor-like protein kinase PERK5. No verified direct reference in this release
At1g49270 Proline-rich receptor-like protein kinase PERK7. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018983 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009611 response to wounding Biological Process
GO:0009620 response to fungus Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009845 seed germination Biological Process
GO:0019722 calcium-mediated signaling Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0048364 root development Biological Process
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0090406 pollen tube Cellular Component
GO:0004672 protein kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G52290
ath:AT2G18470
ath:AT3G24550
ath:AT4G34440
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.862
Rank 1 · TkA05G007310 · TK1151
Cytoplasm0.110
Rank 2 · TkA05G007310 · TK1151
Nucleus0.098
Rank 3 · TkA05G007310 · TK1151
Endoplasmic reticulum0.058
Rank 4 · TkA05G007310 · TK1151
Golgi apparatus0.018
Rank 5 · TkA05G007310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03302VSP152-184 aa
PF04478Mid2154-190 aa
PF02439Adeno_E3_CR2163-192 aa
PF29364TED6164-191 aa
PF12104Tcell_CD4_C170-192 aa
PF00069Pkinase310-511 aa
PF07714PK_Tyr_Ser-Thr312-581 aa
PF03109ABC1315-340 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G007310PF03302VSP1521840.4410.1
TkA05G007310PF04478Mid21541900.2212.0
TkA05G007310PF02439Adeno_E3_CR21631920.01415.9
TkA05G007310PF29364TED61641910.1512.7
TkA05G007310PF12104Tcell_CD4_C1701920.6410.9
TkA05G007310PF00069Pkinase3105115.9e-42144.6
TkA05G007310PF07714PK_Tyr_Ser-Thr3125816e-46157.6
TkA05G007310PF03109ABC13153400.0009219.1
TkA05G007310PF17667Pkinase_fungal4134770.07612.4
TkA05G007310PF03109ABC14184560.0009219.1
TkA05G007310PF12104Tcell_CD4_C5595810.6410.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LV48Arabidopsis thalianasp|Q9LV48|PERK1_ARATH Proline-rich receptor-like protein kinase PERK177.200%Swiss-ProtMedium
Q9ZNQ8Arabidopsis thalianasp|Q9ZNQ8|PERK4_ARATH Proline-rich receptor-like protein kinase PERK475.600%Swiss-ProtMedium
Q9LK03Arabidopsis thalianasp|Q9LK03|PERK2_ARATH Proline-rich receptor-like protein kinase PERK266.000%Swiss-ProtMedium
Q8GX23Arabidopsis thalianasp|Q8GX23|PERK5_ARATH Proline-rich receptor-like protein kinase PERK569.100%Swiss-ProtMedium
Q9XI96Arabidopsis thalianasp|Q9XI96|PERK7_ARATH Proline-rich receptor-like protein kinase PERK765.800%Swiss-ProtMedium

JBrowse

View in Genome Browser