RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G005060
Reference: TK1151 Chr: Chr05 Coordinates: 1485603-1490092 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2691 bp · TkA05G005060|TK1151|cDNA

ATGAAAGGAAGAGATAAAATACTAACAACACTATGAACGGCCGCAATGAAGAAGAAGCCACAGCGAAATAGCAACTCAAATGAACAGGGCACAGGCAAACATACATGGGCTTTTAATCCACCCACTTATATTGTTAGGCCCGACATGCAACTCCAGTCCACTATTAGTCCTCATTTTCCCGCCAAATAGCCATTCTTCGTCCGGCGCCAAATCTATCTCCGCTTTCCCGCGAGTTCATCTACTTCCTCCTCTTCGCCTCA...

CDS

Download CDS FASTA

2037 bp · TkA05G005060|TK1151|CDS

ATGAAGGACGTCGATTTTAGCCGGGACAAAGATCTGGCGAAGGATTTTCTTCAAAACTTCGCTGATGCAGAGGGCGAAGCGAAATATATTAGCATCCTTCAAGATGTCGCCAACAGGAAAGTCAAAGCAATCGAAATTGACCTTGGAGACCTGTTTGATTACAAGGATTTGGACAAAGAGTTTGTGGGACGAGTTACTGAGAACACCCGGAGATATGTTGGAGTTTTTGCCGATGCCATTGATGAGTTGATCCCTGAGCC...

Protein

Download Protein FASTA

678 aa · TkA05G005060|TK1151|PROTEIN

MKDVDFSRDKDLAKDFLQNFADAEGEAKYISILQDVANRKVKAIEIDLGDLFDYKDLDKEFVGRVTENTRRYVGVFADAIDELIPEPTEAFQDDDLDILMTQRAEEGNDNADGTDPRQKMPPEIRRFYEVYIKASSKDQPFTIREVRASHIGQLVKISGIVTRCTDVKPLMKVAVYTCEECGFEIYQEVTARVFMPLFECPSKRCNVNRAKGSLILQLRASKFWKFQEAKLQELTEHVPKGHIPRSMTVHFRGELTRKVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G005060
TK1151 IDTkA05G005060
OH-1004 IDLXL04_018944
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)91.700
Protein coverage (%)TK1151 97.640 / OH-1004 52.138
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G005060
LocationChr05:1485603-1490092 (-)
DescriptionSimilar to MCM7: DNA replication licensing factor MCM7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g02060 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells (By similarity). No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8BMI1 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells. No verified direct reference in this release
Os12g0560700 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018944 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000727 double-strand break repair via break-induced replication Biological Process
GO:0006270 DNA replication initiation Biological Process
GO:0006271 DNA strand elongation involved in DNA replication Biological Process
GO:0006279 premeiotic DNA replication Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0009555 pollen development Biological Process
GO:0010182 sugar mediated signaling pathway Biological Process
GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process
GO:0044786 cell cycle DNA replication Biological Process
GO:0090329 regulation of DNA-templated DNA replication Biological Process
GO:1902975 mitotic DNA replication initiation Biological Process
GO:0000347 THO complex Cellular Component
KEGG gene cross-reference
ath:AT4G02060
dosa:Os12g0560700
spo:2540630
xtr:407945
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.705
Rank 1 · TkA05G005060 · TK1151
Cytoplasm0.318
Rank 2 · TkA05G005060 · TK1151
Plastid0.037
Rank 3 · TkA05G005060 · TK1151
Cell membrane0.025
Rank 4 · TkA05G005060 · TK1151
Mitochondrion0.023
Rank 5 · TkA05G005060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14551MCM_N13-98 aa
PF17207MCM_OB143-274 aa
PF00493MCM303-436 aa
PF05272VapE-like_dom321-379 aa
PF10236DAP3349-382 aa
PF07728AAA_5360-442 aa
PF00493MCM436-496 aa
PF17855MCM_lid513-596 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G005060PF14551MCM_N13982.7e-1041.3
TkA05G005060PF17207MCM_OB1432743.9e-35121.1
TkA05G005060PF00493MCM3034367.2e-79264.7
TkA05G005060PF05272VapE-like_dom3213790.2511.5
TkA05G005060PF10236DAP33493820.2111.5
TkA05G005060PF07728AAA_53604420.01815.8
TkA05G005060PF00493MCM4364967.2e-79264.7
TkA05G005060PF17855MCM_lid5135963.2e-2382.7
TkA05G005060PF10236DAP35396650.2111.5
TkA05G005060PF00493MCM5616057.2e-79264.7
TkA05G005060PF17779WHD_NOD25896200.1512.9
TkA05G005060PF17855MCM_lid6116503.2e-2382.7
TkA05G005060PF24901WHD_MCM76386761.9e-0731.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P43299Arabidopsis thalianasp|P43299|MCM7_ARATH DNA replication licensing factor MCM776.800%Swiss-ProtHigh
B8BMI1Oryza sativa subsp. indicasp|B8BMI1|MCM7_ORYSI DNA replication licensing factor MCM779.300%Swiss-ProtHigh
Q2QNM1Oryza sativa subsp. japonicasp|Q2QNM1|MCM7_ORYSJ DNA replication licensing factor MCM779.100%Swiss-ProtHigh

JBrowse

View in Genome Browser