LXL04_018944 | RubberDandelionOmics

Gene overview

LXL04_018944

Reference: OH-1004 Chr: Chr04 Coordinates: 20283334-20292698 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4002 bp · LXL04_018944|LXL04_018944|OH1004|cDNA

ATGAAGAGGGATAAGAATTCATCCCGATTTAACTTTGAAGCCCCATGGCTATATCATCAGGTACAAAAGTCAAATCTGGAGGGCCTCCTTCAGAGACACGTTGAAATGGCTGCTGAAATCAAGAATCTTGACACTGACTTGCAAATAATGAAGAATAATATTGTTGGTATGGAAGTAAATATGGAGCAACTCCTTGAGAAGATAATGTCAGTGCAGTCGCGAAGTGATGGGTTTATATACGATCTTCCTACTACACTTGG...

CDS

Download CDS FASTA

4002 bp · LXL04_018944|LXL04_018944|OH1004|CDS

ATGAAGAGGGATAAGAATTCATCCCGATTTAACTTTGAAGCCCCATGGCTATATCATCAGGTACAAAAGTCAAATCTGGAGGGCCTCCTTCAGAGACACGTTGAAATGGCTGCTGAAATCAAGAATCTTGACACTGACTTGCAAATAATGAAGAATAATATTGTTGGTATGGAAGTAAATATGGAGCAACTCCTTGAGAAGATAATGTCAGTGCAGTCGCGAAGTGATGGGTTTATATACGATCTTCCTACTACACTTGG...

Protein

Download Protein FASTA

1333 aa · LXL04_018944|LXL04_018944|OH1004|PROTEIN

MKRDKNSSRFNFEAPWLYHQVQKSNLEGLLQRHVEMAAEIKNLDTDLQIMKNNIVGMEVNMEQLLEKIMSVQSRSDGFIYDLPTTLGKCIKSEAYSDAVRFYTGAMPIFKAYGDSSFQDCKKASEEVISVIINKLQEKVSSDSESIQARAEAVMLLKQLDFPVESLKSKLLENLQQFLGELDLSKEISMEGSESQVPTREFVEAVHAYHVIFPDSEQQLVKLVQYLTTRHFEAAKQQIQQQISSAQLSNRLRFIWTDVLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018944`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018944

Location Chr04:20283334-20292698 (-)

Description Similar to MCM7: DNA replication licensing factor MCM7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02060`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BMI1`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release
`Os12g0560700`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018944 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000727 double-strand break repair via break-induced replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006271 DNA strand elongation involved in DNA replication Biological Process

GO:0006279 premeiotic DNA replication Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process

GO:0044786 cell cycle DNA replication Biological Process

GO:0090329 regulation of DNA-templated DNA replication Biological Process

GO:1902975 mitotic DNA replication initiation Biological Process

GO:0000347 THO complex Cellular Component

KEGG gene cross-reference

ath:AT4G02060

dosa:Os12g0560700

spo:2540630

xtr:407945

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.464

Rank 1 · LXL04_018944 · OH-1004

Cytoplasm0.443

Rank 2 · LXL04_018944 · OH-1004

Golgi apparatus0.074

Rank 3 · LXL04_018944 · OH-1004

Endoplasmic reticulum0.056

Rank 4 · LXL04_018944 · OH-1004

Cell membrane0.049

Rank 5 · LXL04_018944 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17207.10MCM_OB761-900 aa

PF00493.30MCM929-1151 aa

PF01078.28Mg_chelatase1040-1101 aa

PF17855.8MCM_lid1168-1251 aa

PF24901.3WHD_MCM71294-1331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018944	`PF17207.10`	MCM_OB	761	900	1.3e-30	106.5
LXL04_018944	`PF00493.30`	MCM	929	1151	1.3e-102	342.4
LXL04_018944	`PF01078.28`	Mg_chelatase	1040	1101	3.9e-06	27.1
LXL04_018944	`PF17855.8`	MCM_lid	1168	1251	2e-22	80.2
LXL04_018944	`PF24901.3`	WHD_MCM7	1294	1331	3.4e-07	30.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43299`	Arabidopsis thaliana	DNA replication licensing factor MCM7	80.174%	Swiss-Prot	moderate database homology
`B8BMI1`	Oryza sativa subsp. indica	DNA replication licensing factor MCM7	83.165%	Swiss-Prot	moderate database homology
`Q2QNM1`	Oryza sativa subsp. japonica	DNA replication licensing factor MCM7	83.022%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card