TkA05G003850 | RubberDandelionOmics

Gene overview

TkA05G003850

Reference: TK1151 Chr: Chr05 Coordinates: 1142508-1149768 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4255 bp · TkA05G003850|TK1151|cDNA

TTCAAAGCGATATATAATGGAGTAGATAGGTTTGTATCTATACAGAAAGGCAGTTTGCTGATTTCACAGCCAGTCGTCAATCCCAGGAAGAGTCGTCTTCTTCTTCGTGTAGTTACTGGAAGCTTTATTGTGTTTAATCAATGTCGACGACTAAGCTGAGCAGAACACATAGTATGCGTGAGCGTGTTGAAAACACTCTCTCGGCACATCGCAACGAAAGTGTTTTCTCCTCTTTCCAGGTATGTAGCTCAGGGGAAGGC...

CDS

Download CDS FASTA

1929 bp · TkA05G003850|TK1151|CDS

ATGTTCCGCAGCAAAGATTGTCTGGAACCACTCCTGGATTTCCTACGTGCACACGGACGTAATGGACATGTGATGATGTTGAATGACCGGATACATAGCATGACTAAACTTCAATCTTCTATATCCAAAGCAGAGGATTATCTCTCTAAGCTACCACCTGATACAGCCTACTCTGAGTTCCAATACGAGATTGCAAGGATTGGGTTTGAAAGAGGATGGGGAAATAATGCTGAAAGAATCCTTGAGATGATGCATCTTCT...

Protein

Download Protein FASTA

642 aa · TkA05G003850|TK1151|PROTEIN

MFRSKDCLEPLLDFLRAHGRNGHVMMLNDRIHSMTKLQSSISKAEDYLSKLPPDTAYSEFQYEIARIGFERGWGNNAERILEMMHLLSDILQAPDPSILETFLGRIPMVFNVVILSIHGYFGQANVLGLPDTGGQIVYILDQVRALENEMVLKLKHQGLDIKPRILIVTRLIPDAKGTSCNQRLERVSGTEHTHILRVPFRTEKGILKKWISRFDVWPYLEKFAEDAASEISAELHGTPDLIIGNYSDGNLVASLLAYKM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G003850`
TK1151 ID	TkA05G003850
OH-1004 ID	LXL04_001165
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.400
Protein coverage (%)	TK1151 99.844 / OH-1004 76.038 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G003850

Location Chr05:1142508-1149768 (-)

Description Similar to SUS2: Sucrose synthase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02280`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	Arabidopsis sucrose synthase 2 and 3 modulate metabolic homeostasis and direct carbon towards starch synthesis in developing seeds.2010 · DOI: 10.1007/s00425-010-1207-9
`At5g49190`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	Arabidopsis sucrose synthase 2 and 3 modulate metabolic homeostasis and direct carbon towards starch synthesis in developing seeds.2010 · DOI: 10.1007/s00425-010-1207-9 Regulation of AtSUS2 and AtSUS3 by glucose and the transcription factor LEC2 in different tissues and at different stages of Arabidopsis seed development.2012 · DOI: 10.1007/s11103-011-9871-0

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0340500`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001165 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0005982 starch metabolic process Biological Process

GO:0005985 sucrose metabolic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010431 seed maturation Biological Process

GO:0010555 response to mannitol Biological Process

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042170 plastid membrane Cellular Component

GO:0016157 sucrose synthase activity Molecular Function

KEGG gene cross-reference

ath:AT4G02280

ath:AT5G49190

dosa:Os03g0340500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.596

Rank 1 · TkA05G003850 · TK1151

Nucleus0.297

Rank 2 · TkA05G003850 · TK1151

Mitochondrion0.086

Rank 3 · TkA05G003850 · TK1151

Cell membrane0.075

Rank 4 · TkA05G003850 · TK1151

Peroxisome0.069

Rank 5 · TkA05G003850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24862SUS_EPBD1-75 aa

PF00862GT-B_Sucrose_synth98-386 aa

PF20706GT4-conflict165-212 aa

PF00534Glycos_transf_1397-572 aa

PF20706GT4-conflict401-545 aa

PF13692Glyco_trans_1_4404-558 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G003850	`PF24862`	SUS_EPBD	1	75	2.8e-23	82.9
TkA05G003850	`PF00862`	GT-B_Sucrose_synth	98	386	1e-167	557.0
TkA05G003850	`PF20706`	GT4-conflict	165	212	0.00011	22.1
TkA05G003850	`PF00534`	Glycos_transf_1	397	572	4.4e-28	98.7
TkA05G003850	`PF20706`	GT4-conflict	401	545	0.00011	22.1
TkA05G003850	`PF13692`	Glyco_trans_1_4	404	558	4.5e-13	50.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M111`	Arabidopsis thaliana	sp\|Q9M111\|SUS3_ARATH Sucrose synthase 3	78.100%	Swiss-Prot	High
`Q00917`	Arabidopsis thaliana	sp\|Q00917\|SUS2_ARATH Sucrose synthase 2	74.800%	Swiss-Prot	High
`Q10LP5`	Oryza sativa subsp. japonica	sp\|Q10LP5\|SUS4_ORYSJ Sucrose synthase 4	78.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card