RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G002190
Reference: TK1151 Chr: Chr05 Coordinates: 646361-649152 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1301 bp · TkA05G002190|TK1151|cDNA

GAAAAATAAATAAAAAGGAAAAAAGCGGCAGCTGTACACCAAAACCAGAGTCTCCTCCGTTTTTGTTTCTTTCATCGCTCATCGATTTGAGCTAACACAAGATCGTCAAAATTTTAGCACAATCCAAGCACAATTTAACCAATTTTCATCAGAGATCGGGAACTGAGCTCACAATATTACAATTTTTTTCCGGTATTTCATTGTTTATGTTTCGATTTCGTTTAGCGAAATTTGTGATTGTTTCCGATCTTGATGTTTCG...

CDS

Download CDS FASTA

831 bp · TkA05G002190|TK1151|CDS

ATGATTTCTGTTGGGAGTAGAGATGGTAGGAAGGGGTTAAGTTTGAGGTATGGTGTTGAAGGTGGAGATATGGATTTAGAGGCTGAACTTGAAGAAGGAGAGGCCTGTTTTCAGAACAATAACGACGATGATTCCACAATTGACCCCGATGTTGCTCTCTCTTATATTGATGAGAAACTTCAAGATGTGTTGGGACATTTTCAGAAGGATTTTGAAGGTGGAGTTTCAGCTGAAAATTTGGGGGCAAAGTTTGGGGGATA...

Protein

Download Protein FASTA

277 aa · TkA05G002190|TK1151|PROTEIN

MISVGSRDGRKGLSLRYGVEGGDMDLEAELEEGEACFQNNNDDDSTIDPDVALSYIDEKLQDVLGHFQKDFEGGVSAENLGAKFGGYGSFLPAYTRSPACPHPKTPPKIPTNNPSVSPNHMHIEGGRQSLVSISNISQSIKHGSVSTSGATTAPPPPPPPLKMNGKSKQEVHMLFNKNGGDKFASSNGQPVNNFANTCDPKSLKVRIKVGSDNLSTRKNAEIYSGLGLDVSPSSSLEASPVDSDDFCHMPNDSPHEESPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G002190
TK1151 IDTkA05G002190
OH-1004 IDLXL04_018870
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.600
Protein coverage (%)TK1151 95.668 / OH-1004 18.176
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G002190
LocationChr05:646361-649152 (+)
DescriptionProtein of unknown function
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0669800 Transcriptional activator that acts as a positive regulator of grain size. No verified direct reference in this release
Os05g0371100 Binds to histones H3K4me1, H3K4me2 and H3K4me3 in GST pull-down assay. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018870 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0080113 regulation of seed growth Biological Process
GO:0005634 nucleus Cellular Component
GO:0008270 zinc ion binding Molecular Function
GO:0043565 sequence-specific DNA binding Molecular Function
KEGG gene cross-reference
dosa:Os03g0347300
dosa:Os05g0371100
dosa:Os07g0669800
osa:4344236
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.551
Rank 1 · TkA05G002190 · TK1151
Nucleus0.351
Rank 2 · TkA05G002190 · TK1151
Cell membrane0.142
Rank 3 · TkA05G002190 · TK1151
Golgi apparatus0.063
Rank 4 · TkA05G002190 · TK1151
Mitochondrion0.060
Rank 5 · TkA05G002190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
A0A0P0X9Z7Oryza sativa subsp. japonicasp|A0A0P0X9Z7|CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 747.000%Swiss-ProtMedium
Q0DIQ5Oryza sativa subsp. japonicasp|Q0DIQ5|CWZF5_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 540.900%Swiss-ProtMedium

JBrowse

View in Genome Browser