TkA04G514880 | RubberDandelionOmics

Gene overview

TkA04G514880

Reference: TK1151 Chr: Chr04 Coordinates: 130106498-130110936 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2141 bp · TkA04G514880|TK1151|cDNA

GTAGGGTGTTACCTAATAAAATAATAGGACCATTTCAAAGCGACGTTCTCGGTAGTGAGAGAGAGGCCTGCGCCCGGGTGAGGGGGGGTGTTTGGCTCAGTTTTCTCTCTCTTCCTGACGCTCCCAGAGACGTATCAACCCAATCGATGGCGAAGCAGCCGATGGTAGCAGTAGTAGACGGCATTGTCACCGACAAGGGTGGTCTACTACCGTACCTCCTTCTCCTTATGCTCGTTTTGATCCTCATCATTATTCTCATC...

CDS

Download CDS FASTA

1038 bp · TkA04G514880|TK1151|CDS

ATGGGTAGCTTGAATGGGACTTTGTTGAATTCCAAGGCAGTCCATTATCCTGAAACTGGAAGTAGACATTGGGGAGATCCTGTGGAGTTGAATAGTGGGGATATAATAACTCTTGGCACATCTTCAAAGATTTCTGTTGAAATTGCATTTGAGAATAATAATAATCATAATAATAATAATAATAATAAGGTTCCGTTTGGAGTTGGAGTAGCATTGGATCCCATGTGTGTGCGTAGAGGTGGGAAGAAACTACCAATGGA...

Protein

Download Protein FASTA

345 aa · TkA04G514880|TK1151|PROTEIN

MGSLNGTLLNSKAVHYPETGSRHWGDPVELNSGDIITLGTSSKISVEIAFENNNNHNNNNNNKVPFGVGVALDPMCVRRGGKKLPMEDVCYYHWPFPGAHQFGLFGIFDGHGGAAAASSASKIMPEMVSRILSDRLRSEKVISHCDASDVLTEAFSQTEAQMDHLYEGCTATVVLIWCDGHDNYFAQCGNVGDSACIANVEGKLVKMSEDHRVATYNERMRMQAATGQPLKDGETRLCGLNLARMLGDKFLKQQDARFSC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G514880`
TK1151 ID	TkA04G514880
OH-1004 ID	LXL04_039198
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.200
Protein coverage (%)	TK1151 100.000 / OH-1004 54.969 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G514880

Location Chr04:130106498-130110936 (+)

Description Similar to KAPP: Protein phosphatase 2C 70

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19280`	Dephosphorylates the Ser/Thr receptor-like kinase RLK5.	The Arabidopsis kinase-associated protein phosphatase controls internalization of the somatic embryogenesis receptor kinase 1.2002 · DOI: 10.1101/gad.220402 The Arabidopsis SERK1 protein interacts with the AAA-ATPase AtCDC48, the 14-3-3 protein GF14lambda and the PP2C phosphatase KAPP.2005 · DOI: 10.1007/s00425-004-1447-7 The Arabidopsis kinase-associated protein phosphatase regulates adaptation to Na+ stress.2008 · DOI: 10.1104/pp.107.109009 A possible role for kinase-associated protein phosphatase in the Arabidopsis CLAVATA1 signaling pathway.1997 · DOI: 10.1073/pnas.94.19.10467 Control of meristem development by CLAVATA1 receptor kinase and kinase-associated protein phosphatase interactions 1998 · DOI: 10.1104/pp.117.4.1217

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0149800`	Probable protein phosphatase 2C 10.	No verified direct reference in this release
`Os04g0659500`	Probable protein phosphatase 2C 45.	No verified direct reference in this release
`Os06g0698300`	Probable protein phosphatase 2C 59.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039198 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0019901 protein kinase binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0050408 [pyruvate kinase]-phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT5G19280

ddi:DDB_G0279461

ddi:DDB_G0282105

dosa:Os02g0149800

dosa:Os04g0659500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · TkA04G514880 · TK1151

Nucleus0.437

Rank 2 · TkA04G514880 · TK1151

Cell membrane0.085

Rank 3 · TkA04G514880 · TK1151

Mitochondrion0.078

Rank 4 · TkA04G514880 · TK1151

Endoplasmic reticulum0.057

Rank 5 · TkA04G514880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00498FHA1-39 aa

PF00481PP2C78-329 aa

PF13672PP2C_2106-266 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G514880	`PF00498`	FHA	1	39	0.084	14.0
TkA04G514880	`PF00481`	PP2C	78	329	1.2e-44	153.6
TkA04G514880	`PF13672`	PP2C_2	106	266	8.5e-07	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46014`	Arabidopsis thaliana	sp\|P46014\|P2C70_ARATH Protein phosphatase 2C 70	59.600%	Swiss-Prot	High
`Q67UX7`	Oryza sativa subsp. japonica	sp\|Q67UX7\|P2C10_ORYSJ Probable protein phosphatase 2C 10	31.700%	Swiss-Prot	Medium
`Q7XR06`	Oryza sativa subsp. japonica	sp\|Q7XR06\|P2C45_ORYSJ Probable protein phosphatase 2C 45	31.300%	Swiss-Prot	Medium
`Q5Z6F5`	Oryza sativa subsp. japonica	sp\|Q5Z6F5\|P2C59_ORYSJ Probable protein phosphatase 2C 59	30.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card