TkA04G502350 | RubberDandelionOmics

Gene overview

TkA04G502350

Reference: TK1151 Chr: Chr04 Coordinates: 126859676-126863379 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2122 bp · TkA04G502350|TK1151|cDNA

GAAATAGTTGGTTACTCTCCCGAGTCAAAATCTCTTCTATTAAAAGATTGCTTTAATGTTTTTACTTTTAAGTTCTAACTTTTAAGCCTCGCTCCACTCTCTCTGAAACACCGGTCTCGACACTACCAACGTCTTTTCTCCGTTCTCAACACTAGCACGAAGCAGTCACAATCGCTATGGCCACCGAAGAAAACGGCAGCACCACCATCGCTATGGGCACCGATGCCCAAAACAGTCACAATTCGTCCCCTTCCAAAAAA...

CDS

Download CDS FASTA

924 bp · TkA04G502350|TK1151|CDS

ATGCTCCACTACGCCTACGGTGCCGTCAAGAAGTCCGTCGAGGCTAACGTAACGCGAGCAGGTGGCCATGTCATAGAGGTTAAGATGCCTTTTCCCGTAGCTTCAAATGACGAAATAATTACAGCATTTAGAAACGCTTTAGAATTGGGAAAATCCAATAACCGTAAAGTTAGGTTAGCTGTCATTGATCACATCACTTCGATGCCATCTGTTGTAATCCCCGTAAAGGAATTGGTAAAGATGTGTAGAGAAGAAGGAGT...

Protein

Download Protein FASTA

307 aa · TkA04G502350|TK1151|PROTEIN

MLHYAYGAVKKSVEANVTRAGGHVIEVKMPFPVASNDEIITAFRNALELGKSNNRKVRLAVIDHITSMPSVVIPVKELVKMCREEGVDRIFVDAAHAIGSITVDVKEIGADFYTSNLHKWLFCPPSVAFLYCKNPELSNLHHPVVSHEYGNGLAIESSWIGTRDYSAQLVVPEALEFVNRFEGGLDGIRERNHQKVIEMADMLAKSWGTNLGSPHDMCSSMAMVGLPACLEIMSDSDGLKLRSHLREIFKVEVPIYYRQP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G502350`
TK1151 ID	TkA04G502350
OH-1004 ID	LXL04_037137
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	69.100
Protein coverage (%)	TK1151 90.228 / OH-1004 61.822 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G502350

Location Chr04:126859676-126863379 (+)

Description Similar to LCD: L-cysteine desulfhydrase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26600`	May catalyze the production of hydrogen sulfide (H2S) from cysteine.	No verified direct reference in this release
`At3g62130`	Catalyzes the production of hydrogen sulfide (H2S) from cysteine.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0290100`	Catalyzes the production of hydrogen sulfide (H2S) from cysteine.	No verified direct reference in this release
`Os01g0290600`	Catalyzes the production of hydrogen sulfide (H2S) from cysteine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037137 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019450 L-cysteine catabolic process to pyruvate Biological Process

GO:1903257 selenoneine biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016846 carbon-sulfur lyase activity Molecular Function

GO:0080146 L-cysteine desulfhydrase activity Molecular Function

GO:1990411 hercynylcysteine sulfoxide lyase activity (ergothioneine-forming) Molecular Function

KEGG gene cross-reference

afm:AFUA_2G13295

ath:AT3G62130

ath:AT5G26600

dosa:Os01g0290100

dosa:Os01g0290600

osa:4325157

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.666

Rank 1 · TkA04G502350 · TK1151

Nucleus0.330

Rank 2 · TkA04G502350 · TK1151

Peroxisome0.068

Rank 3 · TkA04G502350 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkA04G502350 · TK1151

Cell membrane0.055

Rank 5 · TkA04G502350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05889SepSecS12-101 aa

PF23646IgD2_Trs6524-76 aa

PF00266Aminotran_554-212 aa

PF01813ATP-synt_D232-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G502350	`PF05889`	SepSecS	12	101	0.14	11.5
TkA04G502350	`PF23646`	IgD2_Trs65	24	76	0.28	12.2
TkA04G502350	`PF00266`	Aminotran_5	54	212	2.4e-14	53.8
TkA04G502350	`PF01813`	ATP-synt_D	232	297	0.21	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E6S9`	Arabidopsis thaliana	sp\|Q3E6S9\|CNIF3_ARATH Probable L-cysteine desulfhydrase, chloroplastic	70.500%	Swiss-Prot	High
`Q9M1R1`	Arabidopsis thaliana	sp\|Q9M1R1\|LCYD1_ARATH L-cysteine desulfhydrase	61.400%	Swiss-Prot	High
`Q9LGZ2`	Oryza sativa subsp. japonica	sp\|Q9LGZ2\|LCYD1_ORYSJ Putative L-cysteine desulfhydrase 1	65.900%	Swiss-Prot	High
`Q5JNT6`	Oryza sativa subsp. japonica	sp\|Q5JNT6\|LCYD2_ORYSJ Putative L-cysteine desulfhydrase 2	58.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card