TkA04G497490 | RubberDandelionOmics

Gene overview

TkA04G497490

Reference: TK1151 Chr: Chr04 Coordinates: 125644326-125647666 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1735 bp · TkA04G497490|TK1151|cDNA

GAAAGTCTCCCATCCAAATTTGCAAAGATCATGTGGAAGTCCCCATTAAAATTCAGTCGCCAGACATTTCAACATGTTTAAAGTTCAAGAATCTCAGGATCGTTGCTCATATCTCAATCGTTTTATTGCGCTTGTCTGTGAGATACTCACTTAATCTTCGGTGATTGCTTGATCGGTATTGTTCCTGTCGCTAAAGCCCTAACCGAGCAACTGACAAGGTGAAATATCTGAATGAAATAAATTAAATCAATTTGCTACAT...

CDS

Download CDS FASTA

1233 bp · TkA04G497490|TK1151|CDS

ATGATGTTGGTACAAAGTTCCATTGATTCTCTTCGGCTCTCTTCTGTTCCTGACCTTGGAAAACAAGAAATGTTATGTGTCTGGATCCCTGGCAATCAATCATGGCAGGAGCATCCAAATGCCACTCCAGTAACCAAGGACGAGACTTCATCTTCTAGAAACTTCTTAAGTTCTTCCCAGTTATCAACAGAAGGTGACATGCCAGAAACTTCTAAACCTAATCTTGTATACAAACGAAAAAAGACCGGAGAAAGGTCAAA...

Protein

Download Protein FASTA

410 aa · TkA04G497490|TK1151|PROTEIN

MMLVQSSIDSLRLSSVPDLGKQEMLCVWIPGNQSWQEHPNATPVTKDETSSSRNFLSSSQLSTEGDMPETSKPNLVYKRKKTGERSKPTIVYKRKKVQSVCCSSSKSYMELGSVSLKQQQVDDVGECSSSVVVKKDVSETNSCMVFLGNHLVLERRTFNKPTDFENDICSLRACKICEQSALTLKMLICDICEEWFHMFCCNPVVKKIPVGDWFCRDCLRKKFKKMKEVSSEKSPKGYFGLIVAMLRDVDSYKSDVRIGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G497490`
TK1151 ID	TkA04G497490
OH-1004 ID	LXL04_039040
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G497490`
Location	Chr04:125644326-125647666 (-)
Description	Similar to KMT2C: Histone-lysine N-methyltransferase 2C
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039040` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000183 rDNA heterochromatin formation Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0006261 DNA-templated DNA replication Biological Process GO:0006275 regulation of DNA replication Biological Process GO:0006334 nucleosome assembly Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0007338 single fertilization Biological Process GO:0010468 regulation of gene expression Biological Process
KEGG gene cross-reference	hsa:11177 hsa:58508 sce:YJR119C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkA04G497490 · TK1151

Cytoplasm0.084

Rank 2 · TkA04G497490 · TK1151

Cell membrane0.024

Rank 3 · TkA04G497490 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA04G497490 · TK1151

Plastid0.010

Rank 5 · TkA04G497490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01448ELM222-32 aa

PF30811PHD_UBR7-like158-179 aa

PF00628PHD174-218 aa

PF23004PHDvar_NSD174-209 aa

PF30811PHD_UBR7-like177-221 aa

PF07496zf-CW189-221 aa

PF01448ELM2256-282 aa

PF07496zf-CW286-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G497490	`PF01448`	ELM2	22	32	0.0012	20.4
TkA04G497490	`PF30811`	PHD_UBR7-like	158	179	0.0024	18.5
TkA04G497490	`PF00628`	PHD	174	218	9.8e-10	39.0
TkA04G497490	`PF23004`	PHDvar_NSD	174	209	1.8	9.4
TkA04G497490	`PF30811`	PHD_UBR7-like	177	221	0.0024	18.5
TkA04G497490	`PF07496`	zf-CW	189	221	6.3e-05	23.6
TkA04G497490	`PF01448`	ELM2	256	282	0.0012	20.4
TkA04G497490	`PF07496`	zf-CW	286	297	6.3e-05	23.6
TkA04G497490	`PF00628`	PHD	290	303	9.8e-10	39.0
TkA04G497490	`PF07496`	zf-CW	312	366	6.3e-05	23.6
TkA04G497490	`PF23004`	PHDvar_NSD	324	331	1.8	9.4
TkA04G497490	`PF01448`	ELM2	353	357	0.0012	20.4
TkA04G497490	`PF00628`	PHD	355	366	9.8e-10	39.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card