RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G483120
Reference: TK1151 Chr: Chr04 Coordinates: 122056095-122057806 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1565 bp · TkA04G483120|TK1151|cDNA

GAGGGGATCCCTCCCCCTATTAATTTGAACCCCCACTCTTCCAGCCTGCCCCTCCAGTTTGAATACCTGCTACAAGTCTTCATCCCGTTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCGTTGTCTTTCTTTTTCTCTCTCCAAAGCTAGCTTTCAACCCCTCCTTTTTGGGTGACAGTTCGCACAAAAGTATTCTTAAATACAAAACCCTTTATTCATCTTTGTGTCTCAAGCTTATTTGTAGAAT...

CDS

Download CDS FASTA

1371 bp · TkA04G483120|TK1151|CDS

GAGGGGATCCCTCCCCCTATTAATTTGAACCCCCACTCTTCCAGCCTGCCCCTCCAGTTTGAATACCTGCTACAAGTCTTCATCCCGTTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCGTTGTCTTTCTTTTTCTCTCTCCAAAGCTAGCTTTCAACCCCTCCTTTTTGGGTGACAGTTCGCACAAAAGTATTCTTAAATACAAAACCCTTTATTCATCTTTGTGTCTCAAGCTTATTTGTAGAAT...

Protein

Download Protein FASTA

456 aa · TkA04G483120|TK1151|PROTEIN

EGIPPPINLNPHSSSLPLQFEYLLQVFIPFSLSLSLSLSLSLSLVVFLFLSPKLAFNPSFLGDSSHKSILKYKTLYSSLCLKLICRICLVHMGRHSCCYKQKLRKGLWSPEEDEKLIKHITKFGHGCWSSVPKLAGLERCGKSCRLRWINYLRPDLKRGTFSQQEEKLIIELHAVLGNKWSQIAAQLPGRTDNEIKNLWNSSIKKKLRQRGIDPNTHKPLSEVNDDRKDPSGSNEKNSQGSYLEEKTEPLTAAMGSSYPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G483120
TK1151 IDTkA04G483120
OH-1004 IDLXL04_038989
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)98.400
Protein coverage (%)TK1151 98.246 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G483120
LocationChr04:122056095-122057806 (-)
DescriptionSimilar to MYB61: Transcription factor MYB61
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g09540 Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation.
AtMYB61, an R2R3-MYB transcription factor controlling stomatal aperture in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2005.06.041
MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.2009 · DOI: 10.1093/jxb/erp102
AtMYB61, an R2R3-MYB transcription factor, functions as a pleiotropic regulator via a small gene network.2012 · DOI: 10.1111/j.1469-8137.2012.04201.x
Interactions between the R2R3-MYB transcription factor, AtMYB61, and target DNA binding sites.2013 · DOI: 10.1371/journal.pone.0065132
AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.2017 · DOI: 10.1111/tpj.13509
At5g26660 Probable transcription factor. No verified direct reference in this release
At3g61250 Transcription factor that may play a role in flower development by repressing ANT.
Characterization of Arabidopsis MYB transcription factor gene AtMYB17 and its possible regulation by LEAFY and AGL15.2009 · DOI: 10.1016/s1673-8527(08)60096-x
LATE MERISTEM IDENTITY2 acts together with LEAFY to activate APETALA1.2011 · DOI: 10.1242/dev.063073

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038989 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009908 flower development Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0010089 xylem development Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0010214 seed coat development Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
GO:0048364 root development Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
KEGG gene cross-reference
ath:AT1G09540
ath:AT3G61250
ath:AT5G26660
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.844
Rank 1 · TkA04G483120 · TK1151
Cytoplasm0.251
Rank 2 · TkA04G483120 · TK1151
Mitochondrion0.025
Rank 3 · TkA04G483120 · TK1151
Cell membrane0.024
Rank 4 · TkA04G483120 · TK1151
Endoplasmic reticulum0.018
Rank 5 · TkA04G483120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_799-125 aa
PF00249Myb_DNA-binding105-152 aa
PF13921Myb_DNA-bind_6108-167 aa
PF23588HTH_CHD1_Hrp3108-131 aa
PF00249Myb_DNA-binding158-201 aa
PF13921Myb_DNA-bind_6161-210 aa
PF15963Myb_DNA-bind_7161-204 aa
PF26683Tyr_recomb_halo_N193-219 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G483120PF15963Myb_DNA-bind_7991250.02615.1
TkA04G483120PF00249Myb_DNA-binding1051524.8e-33113.7
TkA04G483120PF13921Myb_DNA-bind_61081678.8e-2174.6
TkA04G483120PF23588HTH_CHD1_Hrp31081310.0116.6
TkA04G483120PF00249Myb_DNA-binding1582014.8e-33113.7
TkA04G483120PF13921Myb_DNA-bind_61612108.8e-2174.6
TkA04G483120PF15963Myb_DNA-bind_71612040.02615.1
TkA04G483120PF26683Tyr_recomb_halo_N1932190.1213.2
TkA04G483120PF13921Myb_DNA-bind_64384538.8e-2174.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8VZQ2Arabidopsis thalianasp|Q8VZQ2|MYB61_ARATH Transcription factor MYB6143.200%Swiss-ProtMedium
Q8LPH6Arabidopsis thalianasp|Q8LPH6|MYB86_ARATH Transcription factor MYB8684.500%Swiss-ProtLow
Q9M2D9Arabidopsis thalianasp|Q9M2D9|MYB17_ARATH Transcription factor MYB1769.000%Swiss-ProtLow

JBrowse

View in Genome Browser