Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1274 bp · TkA04G468050|TK1151|cDNA
AAAATTACAGTTTCTGCATTCGTGTCCTCATCTCTTTTCTCCACCGCCTCCTTCTTATCTTTTCACCACGCTTTAAGTGCGACTCTATCTTCCTTCGTTTTTATTTACTCATCCTCGCTTAATGTTCCGGCTCCCTTTTCCTGCAAGTTTGTTTGCCATACTCCTTCAATCGACGAAGTCGAAGCTTTACCTCCACTCCGATCGGCTCCTGCACCATCAGAAAACAACTCGGGGTTTCATGGGATTCCGATTGAACCGAT...
318 bp · TkA04G468050|TK1151|CDS
ATGGAAGATGAGAAAGAAGAAGCGAAATCATACAAAGAATTAGGGCTCTGTTTAAATCTCCGGAAGCCTTCTTACGATGTTTTAGCAGCTTCCTCCACACATGCCGCTACCTGCCAGGGGGAAATGAAGGTAAAGGAAAGTTTGAGTGCAGCCCAGAAGTTTACTCCTGATATTTTTGTTAAACAGTCAAAGATGATCGTGAAGGGACTTATTTTGATTCAGCTGATTGGGCTCTTGGTAAGTCAACTCAACAGCAAACG...
Protein
Download Protein FASTA105 aa · TkA04G468050|TK1151|PROTEIN
MEDEKEEAKSYKELGLCLNLRKPSYDVLAASSTHAATCQGEMKVKESLSAAQKFTPDIFVKQSKMIVKGLILIQLIGLLVSQLNSKREIGNLLVHQMKGKVNMLN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G468050 |
|---|---|
| TK1151 ID | TkA04G468050 |
| OH-1004 ID | LXL04_030346 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 76.700 |
| Protein coverage (%) | TK1151 28.571 / OH-1004 24.390Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G468050 |
|---|---|
| Location | Chr04:118145696-118148302 (-) |
| Description | Similar to SCP2: Sterol carrier protein 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000038 very long-chain fatty acid metabolic process Biological Process GO:0006633 fatty acid biosynthetic process Biological Process GO:0006635 fatty acid beta-oxidation Biological Process GO:0006694 steroid biosynthetic process Biological Process GO:0006701 progesterone biosynthetic process Biological Process GO:0006869 lipid transport Biological Process GO:0008206 bile acid metabolic process Biological Process GO:0008209 androgen metabolic process Biological Process GO:0008210 estrogen metabolic process Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0009646 response to absence of light Biological Process GO:0009744 response to sucrose Biological Process |
| KEGG gene cross-reference | ath:AT5G42890 bta:508918 gga:396550 hsa:6342 rno:79244 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.