TkA04G462510 | RubberDandelionOmics

Gene overview

TkA04G462510

Reference: TK1151 Chr: Chr04 Coordinates: 116727372-116733191 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · TkA04G462510|TK1151|cDNA

ATGCGTAAACCTTTGTTCCTTCGCATTCTCAACGACGTGACGGCTAACTCACAGTTTATGCAGCAACGGTCAGATGCCGCGGGTAGTCAGGGATTTTCTGAGCTTCAGAAATGTGCTGTTGCCATACGTCAGTTGGCATATGGCAGCGTATCAGACAGTTGGGATGAGTACTTCCAGATGTCAGAGCGAATTGCCCTAGAAAGCTTGGACGAATTTTGTAGCTGCATCATCTTTATACTGGGGCAGGTATATGCGCACAC...

CDS

Download CDS FASTA

786 bp · TkA04G462510|TK1151|CDS

ATGCGTAAACCTTTGTTCCTTCGCATTCTCAACGACGTGACGGCTAACTCACAGTTTATGCAGCAACGGTCAGATGCCGCGGGTAGTCAGGGATTTTCTGAGCTTCAGAAATGTGCTGTTGCCATACGTCAGTTGGCATATGGCAGCGTATCAGACAGTTGGGATGAGTACTTCCAGATGTCAGAGCGAATTGCCCTAGAAAGCTTGGACGAATTTTGTAGCTGCATCATCTTTATACTGGGGCAGGTATATGCGCACAC...

Protein

Download Protein FASTA

261 aa · TkA04G462510|TK1151|PROTEIN

MRKPLFLRILNDVTANSQFMQQRSDAAGSQGFSELQKCAVAIRQLAYGSVSDSWDEYFQMSERIALESLDEFCSCIIFILGQVYAHTPTPSDVQALYAHHSQHHGLPANHGQFTQRNRKHATMILEAVASQDLWFWHCYFGPAGSNNDLNVLQMSPIFNHILNGTTPDTSFQLWAVFVKTIAFPDNDVTVKFKRAQERARKDIERAFGALKKCWGILQRGARSTNRDKVARIMYACCILHKMILEDEGKAVCVSSRRKCG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G462510`
TK1151 ID	TkA04G462510
OH-1004 ID	LXL04_013205
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.300
Protein coverage (%)	TK1151 96.552 / OH-1004 47.280 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G462510`
Location	Chr04:116727372-116733191 (+)
Description	Similar to At3g55350: Protein ALP1-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013205` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process GO:0000118 histone deacetylase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0035098 ESC/E(Z) complex Cellular Component GO:0035102 PRC1 complex Cellular Component GO:0003682 chromatin binding Molecular Function GO:0004518 nuclease activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT3G55350 ath:AT3G63270 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.743

Rank 1 · TkA04G462510 · TK1151

Cytoplasm0.268

Rank 2 · TkA04G462510 · TK1151

Extracellular0.065

Rank 3 · TkA04G462510 · TK1151

Cell membrane0.028

Rank 4 · TkA04G462510 · TK1151

Endoplasmic reticulum0.026

Rank 5 · TkA04G462510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28509DUF84181-14 aa

PF13359DDE_Tnp_436-52 aa

PF04827Plant_tran93-172 aa

PF13359DDE_Tnp_4110-240 aa

PF01609DDE_Tnp_1137-238 aa

PF28509DUF8418156-163 aa

PF04827Plant_tran171-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G462510	`PF28509`	DUF8418	1	14	0.013	16.0
TkA04G462510	`PF13359`	DDE_Tnp_4	36	52	3.2e-12	47.0
TkA04G462510	`PF04827`	Plant_tran	93	172	2.5e-43	148.8
TkA04G462510	`PF13359`	DDE_Tnp_4	110	240	3.2e-12	47.0
TkA04G462510	`PF01609`	DDE_Tnp_1	137	238	0.0065	17.0
TkA04G462510	`PF28509`	DUF8418	156	163	0.013	16.0
TkA04G462510	`PF04827`	Plant_tran	171	249	2.5e-43	148.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card