TkA04G461560 | RubberDandelionOmics

Gene overview

TkA04G461560

Reference: TK1151 Chr: Chr04 Coordinates: 116419891-116422268 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1974 bp · TkA04G461560|TK1151|cDNA

ATGAATTTCTTTCTAGCTCCGGCCGTTCTCGCGATTCTCTGTTTGTTAACTTTAATTCAATGTCAAACTACCACCAATTCGACCTCTTGTCCTATAGATTTCGACTACGTGCGCCAAATCCAATGGCCGACCGCCGACTGCCGCCACTCCCGCGACCCAAGCAGGACAGTCACCAATTCCACCACTTGTTGCCAAACCTTGCTTAGCGTCTTCGGCATCGGATTAGCTCAACACCTCAAAGAATCCTCTCTTTTCAACCT...

CDS

Download CDS FASTA

1974 bp · TkA04G461560|TK1151|CDS

ATGAATTTCTTTCTAGCTCCGGCCGTTCTCGCGATTCTCTGTTTGTTAACTTTAATTCAATGTCAAACTACCACCAATTCGACCTCTTGTCCTATAGATTTCGACTACGTGCGCCAAATCCAATGGCCGACCGCCGACTGCCGCCACTCCCGCGACCCAAGCAGGACAGTCACCAATTCCACCACTTGTTGCCAAACCTTGCTTAGCGTCTTCGGCATCGGATTAGCTCAACACCTCAAAGAATCCTCTCTTTTCAACCT...

Protein

Download Protein FASTA

657 aa · TkA04G461560|TK1151|PROTEIN

MNFFLAPAVLAILCLLTLIQCQTTTNSTSCPIDFDYVRQIQWPTADCRHSRDPSRTVTNSTTCCQTLLSVFGIGLAQHLKESSLFNLPDLATSSSCLSDFQSKLNALSLPDNLASFCFDPMQFVISSNTCAAIQTLQDWRRKLGNTTKLDSSCQNDLSDLTECDDCVNAGLTVHKQLSSIDGNSSHSNDCFYFVVLYAAGIVNELGPQSPGAVACTFGINFLSESRKSNRSSLIYGLVGALVAVVVMSCFVGLYFWWDRK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G461560`
TK1151 ID	TkA04G461560
OH-1004 ID	LXL04_030286
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	49.600
Protein coverage (%)	TK1151 95.282 / OH-1004 53.832 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G461560

Location Chr04:116419891-116422268 (+)

Description Similar to At1g77360: Pentatricopeptide repeat-containing protein At1g77360, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11050`	Probable receptor-like protein kinase At1g11050.	No verified direct reference in this release
`At2g48010`	Probable LRR receptor-like serine/threonine-protein kinase RKF3.	No verified direct reference in this release
`At1g56140`	Probable LRR receptor-like serine/threonine-protein kinase At1g56140.	No verified direct reference in this release
`At1g07650`	Probable LRR receptor-like serine/threonine-protein kinase At1g07650.	No verified direct reference in this release
`At1g29720`	Probable LRR receptor-like serine/threonine-protein kinase At1g29720.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030286 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G11050

ath:AT1G52640

ath:AT1G71060

ath:AT1G77360

ath:AT2G48010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.841

Rank 1 · TkA04G461560 · TK1151

Endoplasmic reticulum0.095

Rank 2 · TkA04G461560 · TK1151

Cytoplasm0.075

Rank 3 · TkA04G461560 · TK1151

Nucleus0.052

Rank 4 · TkA04G461560 · TK1151

Lysosome / Vacuole0.036

Rank 5 · TkA04G461560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21314TM_ErbB19-19 aa

PF19160SPARK25-191 aa

PF21314TM_ErbB1234-254 aa

PF01704UDPGP265-301 aa

PF00069Pkinase303-513 aa

PF07714PK_Tyr_Ser-Thr304-510 aa

PF03109ABC1308-330 aa

PF03109ABC1379-465 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G461560	`PF21314`	TM_ErbB1	9	19	0.67	10.4
TkA04G461560	`PF19160`	SPARK	25	191	3e-46	158.5
TkA04G461560	`PF21314`	TM_ErbB1	234	254	0.67	10.4
TkA04G461560	`PF01704`	UDPGP	265	301	0.32	10.4
TkA04G461560	`PF00069`	Pkinase	303	513	2.6e-43	149.0
TkA04G461560	`PF07714`	PK_Tyr_Ser-Thr	304	510	6.5e-41	141.0
TkA04G461560	`PF03109`	ABC1	308	330	0.0025	17.7
TkA04G461560	`PF03109`	ABC1	379	465	0.0025	17.7
TkA04G461560	`PF14531`	Kinase-like	411	535	0.35	10.8
TkA04G461560	`PF17667`	Pkinase_fungal	420	503	0.055	12.9
TkA04G461560	`PF21314`	TM_ErbB1	572	581	0.67	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04086`	Arabidopsis thaliana	sp\|O04086\|Y1105_ARATH Probable receptor-like protein kinase At1g11050	63.500%	Swiss-Prot	High
`P93050`	Arabidopsis thaliana	sp\|P93050\|RKF3_ARATH Probable LRR receptor-like serine/threonine-protein kinase RKF3	37.800%	Swiss-Prot	Medium
`C0LGH3`	Arabidopsis thaliana	sp\|C0LGH3\|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140	40.300%	Swiss-Prot	Medium
`C0LGE0`	Arabidopsis thaliana	sp\|C0LGE0\|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650	37.900%	Swiss-Prot	Medium
`Q9ASQ6`	Arabidopsis thaliana	sp\|Q9ASQ6\|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720	38.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card