LXL04_030286 | RubberDandelionOmics

Gene overview

LXL04_030286

Reference: OH-1004 Chr: Chr06 Coordinates: 113565910-113570139 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3369 bp · LXL04_030286|LXL04_030286|OH1004|cDNA

ATGGGGAAACGGCAGATCTTGTGTCTCATTtgtgtcttcttcttcttcttcttccccaCTTTACATCGTGCAGCAAATTCTACTTCCTGTTCTACAGATTTCAGCTATGTCACCACCTTCCCATGGGACAACTCAGCCTGCCGGACCGCCACCACCAACGGCACCGCCACCCCAAACTGCTGTCAAACTCTCCGGAGCCTCTTCGGCATCGGACTCGCTCACCACCTCAAACAAACCTCGACTTTCTTGTTTCCAAACCT...

CDS

Download CDS FASTA

3369 bp · LXL04_030286|LXL04_030286|OH1004|CDS

ATGGGGAAACGGCAGATCTTGTGTCTCATTTGTGTCTTCTTCTTCTTCTTCTTCCCCACTTTACATCGTGCAGCAAATTCTACTTCCTGTTCTACAGATTTCAGCTATGTCACCACCTTCCCATGGGACAACTCAGCCTGCCGGACCGCCACCACCAACGGCACCGCCACCCCAAACTGCTGTCAAACTCTCCGGAGCCTCTTCGGCATCGGACTCGCTCACCACCTCAAACAAACCTCGACTTTCTTGTTTCCAAACCT...

Protein

Download Protein FASTA

1122 aa · LXL04_030286|LXL04_030286|OH1004|PROTEIN

MGKRQILCLICVFFFFFFPTLHRAANSTSCSTDFSYVTTFPWDNSACRTATTNGTATPNCCQTLRSLFGIGLAHHLKQTSTFLFPNLQSSDSCLSDFQSNLSSISIPQIFSTCLTTTTEFVAVPSNCAEIVTVSDWVNKSGSTTALESSCNVDFAGFLRCSSCLDAGMAVNARLVSLSRNSSKCFTFTALYAAAIVNNFGPEDTRTADCILGITLAKPRSKSKSNKNTIFAIIGALIGTLLFLGAVFAYRRYKNKRKATQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030286`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030286

Location Chr06:113565910-113570139 (+)

Description Similar to At1g77360: Pentatricopeptide repeat-containing protein At1g77360, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77360`	Pentatricopeptide repeat-containing protein At1g77360, mitochondrial.	No verified direct reference in this release
`At1g11050`	Probable receptor-like protein kinase At1g11050.	No verified direct reference in this release
`At2g48010`	Probable LRR receptor-like serine/threonine-protein kinase RKF3.	No verified direct reference in this release
`At1g71060`	Pentatricopeptide repeat-containing protein At1g71060, mitochondrial.	No verified direct reference in this release
`At1g52640`	Pentatricopeptide repeat-containing protein At1g52640, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030286 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G11050

ath:AT1G52640

ath:AT1G71060

ath:AT1G77360

ath:AT2G48010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.460

Rank 1 · LXL04_030286 · OH-1004

Plastid0.251

Rank 2 · LXL04_030286 · OH-1004

Endoplasmic reticulum0.083

Rank 3 · LXL04_030286 · OH-1004

Cytoplasm0.082

Rank 4 · LXL04_030286 · OH-1004

Nucleus0.076

Rank 5 · LXL04_030286 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19160.6SPARK26-185 aa

PF00069.32Pkinase296-514 aa

PF07714.24PK_Tyr_Ser-Thr298-504 aa

PF29070.1MSC6_N737-903 aa

PF17177.11PPR_long765-851 aa

PF13041.13PPR_2775-823 aa

PF23276.3TPR_24779-871 aa

PF13041.13PPR_2809-854 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030286	`PF19160.6`	SPARK	26	185	1.3e-35	123.8
LXL04_030286	`PF00069.32`	Pkinase	296	514	4.6e-41	141.7
LXL04_030286	`PF07714.24`	PK_Tyr_Ser-Thr	298	504	7.2e-42	144.2
LXL04_030286	`PF29070.1`	MSC6_N	737	903	3.8e-27	96.1
LXL04_030286	`PF17177.11`	PPR_long	765	851	4.7e-26	92.2
LXL04_030286	`PF13041.13`	PPR_2	775	823	9.3e-74	244.1
LXL04_030286	`PF23276.3`	TPR_24	779	871	4.4e-25	88.9
LXL04_030286	`PF13041.13`	PPR_2	809	854	9.3e-74	244.1
LXL04_030286	`PF12854.14`	PPR_1	809	838	1.3e-62	207.9
LXL04_030286	`PF13812.13`	PPR_3	809	854	8.4e-35	119.4
LXL04_030286	`PF01535.27`	PPR	813	840	3e-54	178.2
LXL04_030286	`PF13041.13`	PPR_2	861	892	9.3e-74	244.1
LXL04_030286	`PF12854.14`	PPR_1	874	907	1.3e-62	207.9
LXL04_030286	`PF01535.27`	PPR	881	907	3e-54	178.2
LXL04_030286	`PF13041.13`	PPR_2	910	947	9.3e-74	244.1
LXL04_030286	`PF29070.1`	MSC6_N	919	1001	3.8e-27	96.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVX2`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g77360, mitochondrial	65.145%	Swiss-Prot	weak database homology
`O04086`	Arabidopsis thaliana	Probable receptor-like protein kinase At1g11050	49.483%	Swiss-Prot	moderate database homology
`P93050`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase RKF3	39.469%	Swiss-Prot	moderate database homology
`Q9C9A2`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g71060, mitochondrial	40.215%	Swiss-Prot	weak database homology
`Q9SSR6`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g52640, mitochondrial	33.857%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card