TkA04G458430 | RubberDandelionOmics

Gene overview

TkA04G458430

Reference: TK1151 Chr: Chr04 Coordinates: 115639701-115640309 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

609 bp · TkA04G458430|TK1151|cDNA

ATGTCAAACGGGAATCTTGATGACCATTTGTTTCAATCTATGACCGGAAAACCTAAATTGACATGGGCGCAAAGAAAGAACATAATTTTGGATGTCGCAAAAGGGTTAACTTATCTTCACTATGGAGTAAAACCTGCAATTTACCATAGAGACATCAAAGCTACGAATATACTTCTGGATTCAGACATGGGAGCTCGATTGGCGGATTTCGGATTAGTCAAGCAAAGTAGAGAAGGGCAGTCTCACCTGACCACGAGAGT...

CDS

Download CDS FASTA

609 bp · TkA04G458430|TK1151|CDS

ATGTCAAACGGGAATCTTGATGACCATTTGTTTCAATCTATGACCGGAAAACCTAAATTGACATGGGCGCAAAGAAAGAACATAATTTTGGATGTCGCAAAAGGGTTAACTTATCTTCACTATGGAGTAAAACCTGCAATTTACCATAGAGACATCAAAGCTACGAATATACTTCTGGATTCAGACATGGGAGCTCGATTGGCGGATTTCGGATTAGTCAAGCAAAGTAGAGAAGGGCAGTCTCACCTGACCACGAGAGT...

Protein

Download Protein FASTA

202 aa · TkA04G458430|TK1151|PROTEIN

MSNGNLDDHLFQSMTGKPKLTWAQRKNIILDVAKGLTYLHYGVKPAIYHRDIKATNILLDSDMGARLADFGLVKQSREGQSHLTTRVAETHGYLAPEYALYGQLTEKSDVYSFGVVILEIMCGEKSARFFLLGVPFFDYRLGVVDFQRRGCRAGFGSFVIGRWKEHVTDNGEICGCGNFMRSCNGCLQAYDYGGFKDVGREI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G458430`
TK1151 ID	TkA04G458430
OH-1004 ID	LXL04_030286
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.200
Protein coverage (%)	TK1151 61.881 / OH-1004 11.141 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G458430

Location Chr04:115639701-115640309 (-)

Description Similar to At1g77360: Pentatricopeptide repeat-containing protein At1g77360, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11050`	Probable receptor-like protein kinase At1g11050.	No verified direct reference in this release
`At2g48010`	Probable LRR receptor-like serine/threonine-protein kinase RKF3.	No verified direct reference in this release
`At1g07650`	Probable LRR receptor-like serine/threonine-protein kinase At1g07650.	No verified direct reference in this release
`At2g42960`	Probable receptor-like protein kinase At2g42960.	No verified direct reference in this release
`At3g24550`	Proline-rich receptor-like protein kinase PERK1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030286 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G11050

ath:AT1G52640

ath:AT1G71060

ath:AT1G77360

ath:AT2G48010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.535

Rank 1 · TkA04G458430 · TK1151

Nucleus0.309

Rank 2 · TkA04G458430 · TK1151

Cell membrane0.154

Rank 3 · TkA04G458430 · TK1151

Endoplasmic reticulum0.114

Rank 4 · TkA04G458430 · TK1151

Mitochondrion0.068

Rank 5 · TkA04G458430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr1-125 aa

PF00069Pkinase8-125 aa

PF14531Kinase-like19-122 aa

PF17667Pkinase_fungal31-95 aa

PF03109ABC138-80 aa

PF17667Pkinase_fungal119-151 aa

PF03109ABC1177-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G458430	`PF07714`	PK_Tyr_Ser-Thr	1	125	1.1e-24	87.9
TkA04G458430	`PF00069`	Pkinase	8	125	8.8e-26	91.6
TkA04G458430	`PF14531`	Kinase-like	19	122	0.0016	18.5
TkA04G458430	`PF17667`	Pkinase_fungal	31	95	0.079	12.4
TkA04G458430	`PF03109`	ABC1	38	80	0.18	11.7
TkA04G458430	`PF17667`	Pkinase_fungal	119	151	0.079	12.4
TkA04G458430	`PF03109`	ABC1	177	198	0.18	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04086`	Arabidopsis thaliana	sp\|O04086\|Y1105_ARATH Probable receptor-like protein kinase At1g11050	80.100%	Swiss-Prot	Medium
`P93050`	Arabidopsis thaliana	sp\|P93050\|RKF3_ARATH Probable LRR receptor-like serine/threonine-protein kinase RKF3	60.300%	Swiss-Prot	Medium
`C0LGE0`	Arabidopsis thaliana	sp\|C0LGE0\|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650	51.500%	Swiss-Prot	Medium
`Q9SJG2`	Arabidopsis thaliana	sp\|Q9SJG2\|Y2296_ARATH Probable receptor-like protein kinase At2g42960	51.200%	Swiss-Prot	Medium
`Q9LV48`	Arabidopsis thaliana	sp\|Q9LV48\|PERK1_ARATH Proline-rich receptor-like protein kinase PERK1	53.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card