TkA04G452560 | RubberDandelionOmics

Gene overview

TkA04G452560

Reference: TK1151 Chr: Chr04 Coordinates: 114072273-114075703 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1772 bp · TkA04G452560|TK1151|cDNA

AAGTAGACCACTTTGACCCATCAAATACACGGAATTATAGGGAAAACCGATGTTGAATATTGGTTTAATTTAGTCGAGATTTGTTCAACACTTCAACTTCAACCATTCTAGATTTCAATCAAACCACTCTCCTCGGCGACGGCCGGCCGTCCTTTCCTCCGTCCACAACCAGATCAATTTCCAGCGAACACACACGCATGAGTACATATCGAGGAAGGAATCTTCAAGGCAGAGAGAACAGTATCTGAATTCCCGATTAG...

CDS

Download CDS FASTA

1152 bp · TkA04G452560|TK1151|CDS

ATGGAGAGGGTTTTCAGTAAAGTTCGGAATTTGGACGCCTACCCTAAAATTAATGAGGATTTTTACAGCCGTACGCTCTCCGGCGGTGTTATTACCGTCGTCTCCTCCATCGCCATGTTCCTTCTTTTCTTCTCTGAACTCGGGCTATACCTCCACACTGTTACTGAAACAAAGCTTGTAGTTGATACTTCTAGAGGGGAAAAACTACATATTAATTTTGATATCACATTTCCAGCTGTTTCATGTACACTTCTCAGTCT...

Protein

Download Protein FASTA

383 aa · TkA04G452560|TK1151|PROTEIN

MERVFSKVRNLDAYPKINEDFYSRTLSGGVITVVSSIAMFLLFFSELGLYLHTVTETKLVVDTSRGEKLHINFDITFPAVSCTLLSLDAMDISGEQHLDIRHDIIKKRIDINGNVIEERKEGIGGPQIEKPLQRHGGRLEHNETYCGSCFGAEASDDECCNSCEEVREAYRRKGWGMTNPDLIDQCKREGFAQKIKDEEGEGCNIYGSLEVNKVAGNFHFIKSFHQSSIHIPDLLAFQEDSYNISHKINKLAFGEHYPGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G452560`
TK1151 ID	TkA04G452560
OH-1004 ID	LXL04_035806
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.700
Protein coverage (%)	TK1151 99.478 / OH-1004 99.482 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G452560`
Location	Chr04:114072273-114075703 (+)
Description	Similar to ergic3: Endoplasmic reticulum-Golgi intermediate compartment protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035806` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process GO:0090316 positive regulation of intracellular protein transport Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component GO:0016020 membrane Cellular Component GO:0030134 COPII-coated ER to Golgi transport vesicle Cellular Component GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane Cellular Component GO:0061852 retrograde transporter complex, Golgi to ER Cellular Component GO:1990351 transporter complex Cellular Component
KEGG gene cross-reference	dre:393990 hsa:51614 mmu:66366 xla:447415 xtr:407904 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.564

Rank 1 · TkA04G452560 · TK1151

Endoplasmic reticulum0.447

Rank 2 · TkA04G452560 · TK1151

Cytoplasm0.152

Rank 3 · TkA04G452560 · TK1151

Cell membrane0.070

Rank 4 · TkA04G452560 · TK1151

Nucleus0.050

Rank 5 · TkA04G452560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13850ERGIC_N8-97 aa

PF07970COPIIcoated_ERV149-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G452560	`PF13850`	ERGIC_N	8	97	3.7e-32	111.1
TkA04G452560	`PF07970`	COPIIcoated_ERV	149	363	1.6e-81	274.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card