Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1161 bp · LXL04_035806|LXL04_035806|OH1004|cDNA
ATGGAAAGGATAATGAGCAGGATACGGAATTTGGATGCGTATCCTAAGATCAATGAGGACTTCTACAGCAGAACGATCTCCGGTGGTCTCATCACCCTCGTATCCTCCATCTTAAtgcttcttcttttcttctcagAGATGAGATTATATCTTAATTCTGTAACTGAAACAAAGCTAATGGTAGACACCTCAAGAGGAGAACGCCTACGAATCAATTTTGATATCATATTTCCAGCACTTCCATGTACAATACTCAGTAT...
1161 bp · LXL04_035806|LXL04_035806|OH1004|CDS
ATGGAAAGGATAATGAGCAGGATACGGAATTTGGATGCGTATCCTAAGATCAATGAGGACTTCTACAGCAGAACGATCTCCGGTGGTCTCATCACCCTCGTATCCTCCATCTTAATGCTTCTTCTTTTCTTCTCAGAGATGAGATTATATCTTAATTCTGTAACTGAAACAAAGCTAATGGTAGACACCTCAAGAGGAGAACGCCTACGAATCAATTTTGATATCATATTTCCAGCACTTCCATGTACAATACTCAGTAT...
Protein
Download Protein FASTA386 aa · LXL04_035806|LXL04_035806|OH1004|PROTEIN
MERIMSRIRNLDAYPKINEDFYSRTISGGLITLVSSILMLLLFFSEMRLYLNSVTETKLMVDTSRGERLRINFDIIFPALPCTILSIDAMDISGEEHLDIKHDVYKKRLDAYGNVIESRQDGIGTTKIERPLQKHGGRLDHNETYCGSCFGAESSDKECCNSCEDVREAYRKKGWAMSDPDQIDQCKREGFLQRIKDEQGEGCNVYGFLDVNKVAGNFHFAPGKSFQQSNVHVHDLKAFAKDSFNVSHRIIRLAYGDYFP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_035806 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_035806 |
|---|---|
| Location | Chr08:29168661-29171733 (+) |
| Description | Similar to ergic3: Endoplasmic reticulum-Golgi intermediate compartment protein 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process GO:0090316 positive regulation of intracellular protein transport Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component GO:0016020 membrane Cellular Component GO:0030134 COPII-coated ER to Golgi transport vesicle Cellular Component GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane Cellular Component GO:0061852 retrograde transporter complex, Golgi to ER Cellular Component GO:1990351 transporter complex Cellular Component |
| KEGG gene cross-reference | dre:393990 hsa:51614 mmu:66366 xla:447415 xtr:407904 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13850.12ERGIC_N8-97 aaPF07970.18COPIIcoated_ERV149-366 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_035806 | PF13850.12 | ERGIC_N | 8 | 97 | 1.3e-31 | 109.3 |
| LXL04_035806 | PF07970.18 | COPIIcoated_ERV | 149 | 366 | 1.1e-85 | 287.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.