RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G435360
Reference: TK1151 Chr: Chr04 Coordinates: 109786044-109788098 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1501 bp · TkA04G435360|TK1151|cDNA

GGCAATTTAGTCCAACACAACCTTCATAGGTGTTGGTGAGAATTCCCTTGCCTTATTTTAGAAGCCAATAATACTTTGTAACATTTGGGATCCCAAAACCATTTCCTTCATCGTGTCTCCATTCACTGCCACCGTCACCGGAAAAATGCCTTCCGGGGAGGATGGCTCCCCCATCACCTTTCTCAAGAGAGAACTCGAAGCTTCTTTCGTCAAGATTGATTCCTTGGAGAAAGAAAACCATGAATTAAAGCAAGAATTGG...

CDS

Download CDS FASTA

1212 bp · TkA04G435360|TK1151|CDS

ATGCCTTCCGGGGAGGATGGCTCCCCCATCACCTTTCTCAAGAGAGAACTCGAAGCTTCTTTCGTCAAGATTGATTCCTTGGAGAAAGAAAACCATGAATTAAAGCAAGAATTGGGTCGTCTCAATGCACAAATCAATACTTTAAAAGCACATGATCTCGAGAGGAAATCCATCTTATGGAAGAAATTACAGAGTTCGATGGATTGCGGTAAGGTTATAGACGAACCACCACAAAAACCCAAGCTTCAAGTTGAACTACC...

Protein

Download Protein FASTA

403 aa · TkA04G435360|TK1151|PROTEIN

MPSGEDGSPITFLKRELEASFVKIDSLEKENHELKQELGRLNAQINTLKAHDLERKSILWKKLQSSMDCGKVIDEPPQKPKLQVELPDPPLKKSTPNHPEPNVILPKPPPSPPQWLQKRVTAPPPPPPPLPSSPVGSRAVRRVPAVMEFYRSLMKKDTQKENKNGATGFLPVTSRDMIGEIENRSTYLTSIKSDVKKYGQLLNFLIREVQSAAFIEISDVEAFVKWLDGELSCLVDERAVLKHFPHWPERKADALREAAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G435360
TK1151 IDTkA04G435360
OH-1004 IDLXL04_038505
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.500
Protein coverage (%)TK1151 100.000 / OH-1004 95.272
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G435360
LocationChr04:109786044-109788098 (+)
DescriptionSimilar to CHUP1: Protein CHUP1, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g07120 Microtubule-associated protein probably involved in the regulation of microtubule organization. No verified direct reference in this release
At4g18570 Microtubule-associated protein involved in the regulation of anisotropic petal and cotyledons growth and shape by affecting cortical microtubule organization.
Arabidopsis IPGA1 is a microtubule-associated protein essential for cell expansion during petal morphogenesis.2019 · DOI: 10.1093/jxb/erz284
The IPGA1-ANGUSTIFOLIA module regulates microtubule organisation and pavement cell shape in Arabidopsis.2022 · DOI: 10.1111/nph.18433
At3g25690 Required for the positioning and movement of chloroplasts.
Chloroplast unusual positioning1 is essential for proper chloroplast positioning.2003 · DOI: 10.1105/tpc.016428
Chloroplast outer envelope protein CHUP1 is essential for chloroplast anchorage to the plasma membrane and chloroplast movement.2008 · DOI: 10.1104/pp.108.123075
At1g48280 Microtubule-associated protein probably involved in the regulation of microtubule organization. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038505 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009902 chloroplast relocation Biological Process
GO:0030041 actin filament polymerization Biological Process
GO:0043622 cortical microtubule organization Biological Process
GO:0048446 petal morphogenesis Biological Process
GO:0048826 cotyledon morphogenesis Biological Process
GO:0051211 anisotropic cell growth Biological Process
GO:0071260 cellular response to mechanical stimulus Biological Process
GO:0072699 protein localization to cortical microtubule cytoskeleton Biological Process
GO:0090436 leaf pavement cell development Biological Process
GO:0005634 nucleus Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005829 cytosol Cellular Component
KEGG gene cross-reference
ath:AT1G48280
ath:AT3G25690
ath:AT4G04980
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515
Rank 1 · TkA04G435360 · TK1151
Cell membrane0.356
Rank 2 · TkA04G435360 · TK1151
Nucleus0.268
Rank 3 · TkA04G435360 · TK1151
Endoplasmic reticulum0.045
Rank 4 · TkA04G435360 · TK1151
Plastid0.044
Rank 5 · TkA04G435360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29056MYCBP_helical8-50 aa
PF07989Cnn_1N10-50 aa
PF28533DUF842911-50 aa
PF30842LEKR111-63 aa
PF17675APG6_N12-53 aa
PF12709Fungal_TACC12-49 aa
PF28743IPGAL2_N12-38 aa
PF16559GIT_CC13-52 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G435360PF29056MYCBP_helical8500.004317.7
TkA04G435360PF07989Cnn_1N10500.09913.6
TkA04G435360PF28533DUF842911500.02315.3
TkA04G435360PF30842LEKR111631.010.4
TkA04G435360PF17675APG6_N12530.0216.0
TkA04G435360PF12709Fungal_TACC12490.2512.6
TkA04G435360PF28743IPGAL2_N12388.76.9
TkA04G435360PF16559GIT_CC13520.008316.5
TkA04G435360PF30907IPGA1_CC13520.04614.8
TkA04G435360PF27978ZNF318_helical13430.07214.2
TkA04G435360PF05377FlaC_arch13480.113.7
TkA04G435360PF13870CCDC113_CCDC96_CC13500.6110.5
TkA04G435360PF10473CENP-F_leu_zip13610.6310.8
TkA04G435360PF30677CCDC18_1st13580.669.9
TkA04G435360PF25450Rab11-FIP316510.02415.6
TkA04G435360PF13600DUF414016500.611.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LMK4Arabidopsis thalianasp|Q9LMK4|IPGL1_ARATH INCREASED PETAL GROWTH ANISOTROPY 1-like protein 150.800%Swiss-ProtHigh
Q8L7S5Arabidopsis thalianasp|Q8L7S5|IPGA1_ARATH Protein INCREASED PETAL GROWTH ANISOTROPY 152.800%Swiss-ProtMedium
Q9LI74Arabidopsis thalianasp|Q9LI74|CHUP1_ARATH Protein CHUP1, chloroplastic51.900%Swiss-ProtMedium
Q9SX62Arabidopsis thalianasp|Q9SX62|IPGL2_ARATH INCREASED PETAL GROWTH ANISOTROPY 1-like protein 231.500%Swiss-ProtMedium

JBrowse

View in Genome Browser