LXL04_038505 | RubberDandelionOmics

Gene overview

LXL04_038505

Reference: OH-1004 Chr: Chr09 Coordinates: 42623016-42624878 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1284 bp · LXL04_038505|LXL04_038505|OH1004|cDNA

ACTTTGTAACATTTGGGATCCCAAACCATTTCCttcatcgtgtctccattcaCTGCCACCGTCACCGGAAAAATGCCTTCCGGTGAGGATGGCTCCCCCATCACCTTTCTCAAGAGAGAACTCGAAGCTTCTTTCGTCAAGATCGATTCCTTGGAGAAAGAAAACCATGAATTAAAGCAAGAATTGGGTCGTCTCAAGGCACAAATCAATACTTTAAAAGCACATGATCTCGAGAGGAAATCCATCTTATGGAAGAAATT...

CDS

Download CDS FASTA

1272 bp · LXL04_038505|LXL04_038505|OH1004|CDS

TTGGGATCCCAAACCATTTCCTTCATCGTGTCTCCATTCACTGCCACCGTCACCGGAAAAATGCCTTCCGGTGAGGATGGCTCCCCCATCACCTTTCTCAAGAGAGAACTCGAAGCTTCTTTCGTCAAGATCGATTCCTTGGAGAAAGAAAACCATGAATTAAAGCAAGAATTGGGTCGTCTCAAGGCACAAATCAATACTTTAAAAGCACATGATCTCGAGAGGAAATCCATCTTATGGAAGAAATTACAGAGTTCGAT...

Protein

Download Protein FASTA

423 aa · LXL04_038505|LXL04_038505|OH1004|PROTEIN

MGSQTISFIVSPFTATVTGKMPSGEDGSPITFLKRELEASFVKIDSLEKENHELKQELGRLKAQINTLKAHDLERKSILWKKLQSSMDCGKVIDEPPQKPKLQVELPDPPLKKSTPNHPEPNVILPKPPPSPPQWLQKRVTAPPPPPPPLPSSPVGSRAVRRVPAVMEFYRSLMKKDTQKENKNGATGFLPVTSRDMIGEIENRSTYLTSIKSDVKKYGQLLNFLIREVQSAAFIEISDVEAFVKWLDGELSCLVDERAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038505`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038505

Location Chr09:42623016-42624878 (+)

Description Similar to CHUP1: Protein CHUP1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07120`	Microtubule-associated protein probably involved in the regulation of microtubule organization.	No verified direct reference in this release
`At4g18570`	Microtubule-associated protein involved in the regulation of anisotropic petal and cotyledons growth and shape by affecting cortical microtubule organization.	Arabidopsis IPGA1 is a microtubule-associated protein essential for cell expansion during petal morphogenesis.2019 · DOI: 10.1093/jxb/erz284 The IPGA1-ANGUSTIFOLIA module regulates microtubule organisation and pavement cell shape in Arabidopsis.2022 · DOI: 10.1111/nph.18433
`At3g25690`	Required for the positioning and movement of chloroplasts.	Chloroplast unusual positioning1 is essential for proper chloroplast positioning.2003 · DOI: 10.1105/tpc.016428 Chloroplast outer envelope protein CHUP1 is essential for chloroplast anchorage to the plasma membrane and chloroplast movement.2008 · DOI: 10.1104/pp.108.123075
`At1g48280`	Microtubule-associated protein probably involved in the regulation of microtubule organization.	No verified direct reference in this release
`At4g04980`	Uncharacterized protein At4g04980.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038505 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009902 chloroplast relocation Biological Process

GO:0030041 actin filament polymerization Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0048446 petal morphogenesis Biological Process

GO:0048826 cotyledon morphogenesis Biological Process

GO:0051211 anisotropic cell growth Biological Process

GO:0071260 cellular response to mechanical stimulus Biological Process

GO:0072699 protein localization to cortical microtubule cytoskeleton Biological Process

GO:0090436 leaf pavement cell development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G48280

ath:AT3G25690

ath:AT4G04980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.503

Rank 1 · LXL04_038505 · OH-1004

Cell membrane0.360

Rank 2 · LXL04_038505 · OH-1004

Nucleus0.270

Rank 3 · LXL04_038505 · OH-1004

Plastid0.047

Rank 4 · LXL04_038505 · OH-1004

Endoplasmic reticulum0.046

Rank 5 · LXL04_038505 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26700.1IPGAL1_C275-419 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038505	`PF26700.1`	IPGAL1_C	275	419	7.6e-64	214.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMK4`	Arabidopsis thaliana	INCREASED PETAL GROWTH ANISOTROPY 1-like protein 1	52.141%	Swiss-Prot	strong database homology
`Q8L7S5`	Arabidopsis thaliana	Protein INCREASED PETAL GROWTH ANISOTROPY 1	52.399%	Swiss-Prot	moderate database homology
`Q9LI74`	Arabidopsis thaliana	Protein CHUP1, chloroplastic	52.652%	Swiss-Prot	moderate database homology
`Q9SX62`	Arabidopsis thaliana	INCREASED PETAL GROWTH ANISOTROPY 1-like protein 2	36.946%	Swiss-Prot	moderate database homology
`Q1PEB4`	Arabidopsis thaliana	Uncharacterized protein At4g04980	29.680%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card