TkA04G389270 | RubberDandelionOmics

Gene overview

TkA04G389270

Reference: TK1151 Chr: Chr04 Coordinates: 97918401-97920801 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1430 bp · TkA04G389270|TK1151|cDNA

CTTAATGACAGTAGAATTTCATGATCAAGATCGAGAGAGATACAAATTTTGAAAATTCCGTATAAATTTTCTAGAGAGAGAACGCAGATTTCTTTTGGAAAAGAATATTTTGGCAGATTTTCCATTCATTACATTGATAGACCATTCATAAATCTAAGCGTGGTGTTGAGATTTCCATGCCTTCTTCATTGAATTCATATTTTCTCTGTACTTGATCATCACCAACAGCGGATAAATTTTTTATTTTTCTCGGATTAGGT...

CDS

Download CDS FASTA

822 bp · TkA04G389270|TK1151|CDS

ATGCCAGAAAATCGGCGTGTTCAGAGGAATAGTGTCATCTCCAATTCTTCGTTGAATCCTTCTGGTCATAACATCGAAGACGCTATAAGGCGATTGAGAATTCACTCAGATGGGAAAGAAGACGAGATCGATTCACCGGTCTATCCAGATCGACCTGGAGAACCCGATTGCATATACTATTTAAGAACCGGAGTGTGTGGCTATGGTGATAATTGCAGGTTTAATCATCCAACTTACACCGGCCAGATTAATCACCATGG...

Protein

Download Protein FASTA

273 aa · TkA04G389270|TK1151|PROTEIN

MPENRRVQRNSVISNSSLNPSGHNIEDAIRRLRIHSDGKEDEIDSPVYPDRPGEPDCIYYLRTGVCGYGDNCRFNHPTYTGQINHHGGDLPERVGEPDCVYFLKTGTCKYGSTCKYNHPHDRRGLGPVILNSVGLPMRQDQKSCSHYLRTGSCKFGVTCKFHHPQPPMEPPHHGGGPPPLWPYPAPQTYFPIMLPPSAVTQAWSPLGLPLRPGQPVCSYYSHYGICKYGPSCKYDHPLMVYSYNYTMGMMTSSVLPYVTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G389270`
TK1151 ID	TkA04G389270
OH-1004 ID	LXL04_017584
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	56.900
Protein coverage (%)	TK1151 86.813 / OH-1004 72.658 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G389270

Location Chr04:97918401-97920801 (+)

Description Similar to At1g04990: Zinc finger CCCH domain-containing protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04990`	Possesses RNA-binding and ribonuclease activities in vitro.	No verified direct reference in this release
`At2g32930`	Zinc finger CCCH domain-containing protein 26.	No verified direct reference in this release
`At3g06410`	Zinc finger CCCH domain-containing protein 34.	No verified direct reference in this release
`At3g02830`	Zinc finger CCCH domain-containing protein 33.	No verified direct reference in this release
`At5g18550`	Zinc finger CCCH domain-containing protein 58.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017584 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0004518 nuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0010313 phytochrome binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0048027 mRNA 5'-UTR binding Molecular Function

KEGG gene cross-reference

ath:AT1G04990

ath:AT2G32930

ath:AT3G02830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.781

Rank 1 · TkA04G389270 · TK1151

Cytoplasm0.334

Rank 2 · TkA04G389270 · TK1151

Cell membrane0.030

Rank 3 · TkA04G389270 · TK1151

Endoplasmic reticulum0.019

Rank 4 · TkA04G389270 · TK1151

Mitochondrion0.017

Rank 5 · TkA04G389270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00642zf-CCCH52-77 aa

PF25585zf-CCCH_DUS3L54-76 aa

PF14608zf-CCCH_256-77 aa

PF16131Torus56-77 aa

PF15663zf-CCCH_356-77 aa

PF18345zf_CCCH_457-76 aa

PF18044zf-CCCH_459-77 aa

PF30206DEF26562-75 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G389270	`PF00642`	zf-CCCH	52	77	1.6e-37	127.4
TkA04G389270	`PF25585`	zf-CCCH_DUS3L	54	76	3.4e-15	56.4
TkA04G389270	`PF14608`	zf-CCCH_2	56	77	1.5e-12	48.2
TkA04G389270	`PF16131`	Torus	56	77	5.4e-07	30.9
TkA04G389270	`PF15663`	zf-CCCH_3	56	77	0.31	11.9
TkA04G389270	`PF18345`	zf_CCCH_4	57	76	3.9e-19	68.8
TkA04G389270	`PF18044`	zf-CCCH_4	59	77	4.8e-12	46.1
TkA04G389270	`PF30206`	DEF265	62	75	2.6	8.5
TkA04G389270	`PF30063`	Metallothionein	63	73	1.4	10.0
TkA04G389270	`PF25586`	zf-CCCH_PAN3	64	78	0.03	14.7
TkA04G389270	`PF00642`	zf-CCCH	96	119	1.6e-37	127.4
TkA04G389270	`PF25585`	zf-CCCH_DUS3L	96	118	3.4e-15	56.4
TkA04G389270	`PF14608`	zf-CCCH_2	98	119	1.5e-12	48.2
TkA04G389270	`PF16131`	Torus	98	118	5.4e-07	30.9
TkA04G389270	`PF15663`	zf-CCCH_3	98	120	0.31	11.9
TkA04G389270	`PF18345`	zf_CCCH_4	99	118	3.9e-19	68.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AD9`	Arabidopsis thaliana	sp\|Q94AD9\|C3H3_ARATH Zinc finger CCCH domain-containing protein 3	56.300%	Swiss-Prot	Low
`O48772`	Arabidopsis thaliana	sp\|O48772\|C3H26_ARATH Zinc finger CCCH domain-containing protein 26	56.600%	Swiss-Prot	Low
`Q9SQU4`	Arabidopsis thaliana	sp\|Q9SQU4\|C3H34_ARATH Zinc finger CCCH domain-containing protein 34	50.000%	Swiss-Prot	Low
`Q8GXX7`	Arabidopsis thaliana	sp\|Q8GXX7\|C3H33_ARATH Zinc finger CCCH domain-containing protein 33	45.600%	Swiss-Prot	Low
`Q6NPN3`	Arabidopsis thaliana	sp\|Q6NPN3\|C3H58_ARATH Zinc finger CCCH domain-containing protein 58	58.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card