TkA04G387280 | RubberDandelionOmics

Gene overview

TkA04G387280

Reference: TK1151 Chr: Chr04 Coordinates: 97430933-97431235 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

303 bp · TkA04G387280|TK1151|cDNA

ATGGAGGAGATGATTGAAGGTATACGGCGGTTTCATGAACAACCACAGGAGGTGAAGATGGAGTGGTATTCGCGCGAAAATGAAGAAAAAGTGAAGTATTACTCTAATGGCGATCTTTATGTTTCGAAAGCGGTGAGTTGGCGAGACTCCATATCGTGTCACTATGCTGACGGTGCACTTGATCCTAATCAATTGCCACATGCTTTCAGGTATTGTATAAAATTGACATTGACGACTATGTTAAATTTTACAAAATTTAA...

CDS

Download CDS FASTA

303 bp · TkA04G387280|TK1151|CDS

ATGGAGGAGATGATTGAAGGTATACGGCGGTTTCATGAACAACCACAGGAGGTGAAGATGGAGTGGTATTCGCGCGAAAATGAAGAAAAAGTGAAGTATTACTCTAATGGCGATCTTTATGTTTCGAAAGCGGTGAGTTGGCGAGACTCCATATCGTGTCACTATGCTGACGGTGCACTTGATCCTAATCAATTGCCACATGCTTTCAGGTATTGTATAAAATTGACATTGACGACTATGTTAAATTTTACAAAATTTAA...

Protein

Download Protein FASTA

100 aa · TkA04G387280|TK1151|PROTEIN

MEEMIEGIRRFHEQPQEVKMEWYSRENEEKVKYYSNGDLYVSKAVSWRDSISCHYADGALDPNQLPHAFRYCIKLTLTTMLNFTKFNDNHRVGKILFNRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G387280`
TK1151 ID	TkA04G387280
OH-1004 ID	LXL04_022968
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 70.000 / OH-1004 97.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G387280

Location Chr04:97430933-97431235 (-)

Description Similar to GSL-OH: Probable 2-oxoacid dependent dioxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06650`	1-aminocyclopropane-1-carboxylate oxidase homolog 3.	No verified direct reference in this release
`At1g04350`	1-aminocyclopropane-1-carboxylate oxidase homolog 6.	No verified direct reference in this release
`At5g59540`	1-aminocyclopropane-1-carboxylate oxidase homolog 12.	No verified direct reference in this release
`At5g59530`	1-aminocyclopropane-1-carboxylate oxidase homolog 11.	No verified direct reference in this release
`At1g04380`	1-aminocyclopropane-1-carboxylate oxidase homolog 7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022968 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0009815 1-aminocyclopropane-1-carboxylate oxidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G03410

ath:AT1G06620

ath:AT1G06640

ath:AT1G06650

ath:AT2G25450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.419

Rank 1 · TkA04G387280 · TK1151

Cytoplasm0.391

Rank 2 · TkA04G387280 · TK1151

Mitochondrion0.170

Rank 3 · TkA04G387280 · TK1151

Cell membrane0.074

Rank 4 · TkA04G387280 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA04G387280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N1-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G387280	`PF14226`	DIOX_N	1	67	0.00011	23.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1S4`	Arabidopsis thaliana	sp\|Q8H1S4\|ACCH3_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 3	40.700%	Swiss-Prot	Medium
`P93824`	Arabidopsis thaliana	sp\|P93824\|ACCH6_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 6	36.700%	Swiss-Prot	Medium
`Q9LTH7`	Arabidopsis thaliana	sp\|Q9LTH7\|ACH12_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 12	44.400%	Swiss-Prot	Medium
`Q9LTH8`	Arabidopsis thaliana	sp\|Q9LTH8\|ACH11_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 11	45.200%	Swiss-Prot	Medium
`P93821`	Arabidopsis thaliana	sp\|P93821\|ACCH7_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 7	38.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card