LXL04_022968 | RubberDandelionOmics

Gene overview

LXL04_022968

Reference: OH-1004 Chr: Chr05 Coordinates: 15727660-15728592 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

219 bp · LXL04_022968|LXL04_022968|OH1004|cDNA

ATGGAGGAGATGATTGAAGGTATACGGCGGTTTCATGAACAACCACAGGAGGTGAAGATGGAGTGGTATTCGCGCGAAAATGAAGAAAAAGTGAAGTATTACTCTAATGGCGATCTTTATGTTTCGAAAGCGGTGAGTTGGCGAGACTCCATATCGTGTCACTATGCTGACGGTGCACTTGATCCTAATCAATTGCCACATGCTTTCAGGGGCTGGTAA

CDS

Download CDS FASTA

219 bp · LXL04_022968|LXL04_022968|OH1004|CDS

ATGGAGGAGATGATTGAAGGTATACGGCGGTTTCATGAACAACCACAGGAGGTGAAGATGGAGTGGTATTCGCGCGAAAATGAAGAAAAAGTGAAGTATTACTCTAATGGCGATCTTTATGTTTCGAAAGCGGTGAGTTGGCGAGACTCCATATCGTGTCACTATGCTGACGGTGCACTTGATCCTAATCAATTGCCACATGCTTTCAGGGGCTGGTAA

Protein

Download Protein FASTA

72 aa · LXL04_022968|LXL04_022968|OH1004|PROTEIN

MEEMIEGIRRFHEQPQEVKMEWYSRENEEKVKYYSNGDLYVSKAVSWRDSISCHYADGALDPNQLPHAFRGW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022968`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022968

Location Chr05:15727660-15728592 (-)

Description Similar to GSL-OH: Probable 2-oxoacid dependent dioxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25450`	Necessary for the hydroxylation of but-3-enyl glucosinolate to 2-hydroxybut-3-enyl glucosinolate, which is toxic to insects, bacteria and nematodes, inhibits seed germination and produces bitter flavors.	A novel 2-oxoacid-dependent dioxygenase involved in the formation of the goiterogenic 2-hydroxybut-3-enyl glucosinolate and generalist insect resistance in Arabidopsis,.2008 · DOI: 10.1104/pp.108.129981
`At1g06620`	1-aminocyclopropane-1-carboxylate oxidase homolog 1.	No verified direct reference in this release
`At1g03410`	1-aminocyclopropane-1-carboxylate oxidase homolog 5.	No verified direct reference in this release
`At1g06650`	1-aminocyclopropane-1-carboxylate oxidase homolog 3.	No verified direct reference in this release
`At1g06640`	1-aminocyclopropane-1-carboxylate oxidase homolog 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022968 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0009815 1-aminocyclopropane-1-carboxylate oxidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G03410

ath:AT1G06620

ath:AT1G06640

ath:AT1G06650

ath:AT2G25450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.519

Rank 1 · LXL04_022968 · OH-1004

Cytoplasm0.375

Rank 2 · LXL04_022968 · OH-1004

Extracellular0.095

Rank 3 · LXL04_022968 · OH-1004

Mitochondrion0.081

Rank 4 · LXL04_022968 · OH-1004

Cell membrane0.051

Rank 5 · LXL04_022968 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKK4`	Arabidopsis thaliana	Probable 2-oxoacid dependent dioxygenase	51.515%	Swiss-Prot	strong database homology
`Q84MB3`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 1	48.485%	Swiss-Prot	moderate database homology
`Q43383`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 5	53.030%	Swiss-Prot	strong database homology
`Q8H1S4`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 3	45.714%	Swiss-Prot	moderate database homology
`Q9C5K7`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 2	44.286%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card