TkA04G372490 | RubberDandelionOmics

Gene overview

TkA04G372490

Reference: TK1151 Chr: Chr04 Coordinates: 93581218-93584628 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1310 bp · TkA04G372490|TK1151|cDNA

AAAAATTGAAACTGAAGAATGTATTTTGCCCTAACCTAGTCTCGGCCGCACTGTCTCTCTTAGTCTCTCCCGGTCGCTGCCTGCCTTCCTCGCCAAATCGATTTCACCCTTTCCAAGTTTCCATCGGCGACCTGCGGCGACAATAGGCGACCACCTGCACTGCTCCATCGACGACCACCTGCTCTGCTCCGCAATTCTCCGCTGTTGACCTGCTAAAGCAACTCGGTAAAAATGGTGGGATTATCTATTGGAGAAAAGCA...

CDS

Download CDS FASTA

567 bp · TkA04G372490|TK1151|CDS

ATGGAACTCTCTGCAGCCTTGAGACAATGTCTTTTAGGAGGGAAAAGTGGGGCAGGAGCTGGAATTAATCTTTCATCTTTGGCAATTGTGGATGGGAAGGTCTGTTGGGATTTATATATCGATGGTCTTGTGATTAATATTGATGGAAATATACTCGATGCCTTAGGTGCTGCCATCAAGGCTGCTTTAAGCAATACCGGCATCCCAAAAGTGAACGTGTCATCAACCGCCCCTTCTGATGACCAACCAGAAGTCGATGT...

Protein

Download Protein FASTA

188 aa · TkA04G372490|TK1151|PROTEIN

MELSAALRQCLLGGKSGAGAGINLSSLAIVDGKVCWDLYIDGLVINIDGNILDALGAAIKAALSNTGIPKVNVSSTAPSDDQPEVDVSDEEFLQFDTTAVPVIVTLTKVGRHYIVDATSEEESQMSSAVSVSVNRGGMICGLTKRGGAGLDPSVILDMISVGKHVSEQLMNKLDSEIAKAEAAMEEES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G372490`
TK1151 ID	TkA04G372490
OH-1004 ID	LXL04_037990
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 65.278 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G372490`
Location	Chr04:93581218-93584628 (+)
Description	Similar to EXOSC7: Exosome complex component RRP42
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037990` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0006396 RNA processing Biological Process GO:0006401 RNA catabolic process Biological Process GO:0016075 rRNA catabolic process Biological Process GO:0034473 U1 snRNA 3'-end processing Biological Process GO:0034475 U4 snRNA 3'-end processing Biological Process GO:0034476 U5 snRNA 3'-end processing Biological Process GO:0071028 nuclear mRNA surveillance Biological Process GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process Biological Process GO:0071038 TRAMP-dependent tRNA surveillance pathway Biological Process GO:0000176 nuclear exosome (RNase complex) Cellular Component
KEGG gene cross-reference	ddi:DDB_G0280251 hsa:23016 mka:MK0380 mmu:66446 mth:MTH_682 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.755

Rank 1 · TkA04G372490 · TK1151

Cytoplasm0.435

Rank 2 · TkA04G372490 · TK1151

Lysosome / Vacuole0.046

Rank 3 · TkA04G372490 · TK1151

Cell membrane0.030

Rank 4 · TkA04G372490 · TK1151

Golgi apparatus0.030

Rank 5 · TkA04G372490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01138RNase_PH25-69 aa

PF03725RNase_PH_C80-91 aa

PF01138RNase_PH91-133 aa

PF03725RNase_PH_C100-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G372490	`PF01138`	RNase_PH	25	69	1e-06	29.9
TkA04G372490	`PF03725`	RNase_PH_C	80	91	2.2e-12	47.5
TkA04G372490	`PF01138`	RNase_PH	91	133	1e-06	29.9
TkA04G372490	`PF03725`	RNase_PH_C	100	163	2.2e-12	47.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card