Gene Card
Gene overview
cDNA / CDS / Protein Sequences
867 bp · LXL04_037990|LXL04_037990|OH1004|cDNA
ATGGTGGGATTATCTATTGGAGAAAAGCATTTTATACAGGGTGGAATTGCTCAAGACCTCCGTACAGATGGCCGTAAAAGATTAAGTTACCGCCCCATATCTGTTGAAACTGGAGTCATTGCTCAGGCAAATGGGTCAGCAAGAGTGAAGATGGGTAAAACTGAAGTCATAGCGAGTGTGAAGGCTGAATTAGGAAGACCAAGTTCTTCAGCTCCTGACAAAGGAAAAGTTTCCATATACATCGATTGCAGTTCCACAGC...
867 bp · LXL04_037990|LXL04_037990|OH1004|CDS
ATGGTGGGATTATCTATTGGAGAAAAGCATTTTATACAGGGTGGAATTGCTCAAGACCTCCGTACAGATGGCCGTAAAAGATTAAGTTACCGCCCCATATCTGTTGAAACTGGAGTCATTGCTCAGGCAAATGGGTCAGCAAGAGTGAAGATGGGTAAAACTGAAGTCATAGCGAGTGTGAAGGCTGAATTAGGAAGACCAAGTTCTTCAGCTCCTGACAAAGGAAAAGTTTCCATATACATCGATTGCAGTTCCACAGC...
Protein
Download Protein FASTA288 aa · LXL04_037990|LXL04_037990|OH1004|PROTEIN
MVGLSIGEKHFIQGGIAQDLRTDGRKRLSYRPISVETGVIAQANGSARVKMGKTEVIASVKAELGRPSSSAPDKGKVSIYIDCSSTAAPQYEGRGGEELSMELSAALRQCLLGGKSGAGAGINLSSLAIVDGKVCWDLYIDGLVINIDGNILDALGAAIKAALSNTGIPKVNVSSTAPSDDQPEVDVSDEEFLQFDTTAVPVIVTLTKVGRHYIVDATSEEESQMSSAVSVSVNRGGMICGLTKRGGAGLDPSVILDMIS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_037990 |
|---|---|
| TK1151 ID | TkA04G372490 |
| OH-1004 ID | LXL04_037990 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 65.278Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_037990 |
|---|---|
| Location | Chr09:27603650-27605441 (+) |
| Description | Similar to EXOSC7: Exosome complex component RRP42 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0006396 RNA processing Biological Process GO:0006401 RNA catabolic process Biological Process GO:0016075 rRNA catabolic process Biological Process GO:0034473 U1 snRNA 3'-end processing Biological Process GO:0034475 U4 snRNA 3'-end processing Biological Process GO:0034476 U5 snRNA 3'-end processing Biological Process GO:0071028 nuclear mRNA surveillance Biological Process GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process Biological Process GO:0071038 TRAMP-dependent tRNA surveillance pathway Biological Process GO:0000176 nuclear exosome (RNase complex) Cellular Component |
| KEGG gene cross-reference | ddi:DDB_G0280251 hsa:23016 mka:MK0380 mmu:66446 mth:MTH_682 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01138.28RNase_PH30-169 aaPF03725.21RNase_PH_C200-263 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_037990 | PF01138.28 | RNase_PH | 30 | 169 | 2.6e-25 | 90.1 |
| LXL04_037990 | PF03725.21 | RNase_PH_C | 200 | 263 | 7e-12 | 45.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.