TkA04G358450 | RubberDandelionOmics

Gene overview

TkA04G358450

Reference: TK1151 Chr: Chr04 Coordinates: 90321123-90325779 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2250 bp · TkA04G358450|TK1151|cDNA

TTGGGAAAGTGTTGTTCCACAAAGTAACAAACTATTAAACAGGGGAGGCGCCTGAAGGCAGGGGAAAAAGGGGGGGAGGCATCCGGGCATGCCAACGGACTCCTTCAACACACACAAACTCACTCGATTCTCCAGTAGTCGTTCACAATCTTCACCGCCGGACGACCACCACCAACCACCAACTACCACCCATCACCGTCTCATTGATCAGAGCGAGACATAGCTAGAGAAGGAGAACAAAGTCCGAGGGATGCGATCCT...

CDS

Download CDS FASTA

1674 bp · TkA04G358450|TK1151|CDS

ATGGCTGGTTTCCAATTGCAAATGACTTGGCAAACGAATTTGCTGAAGAAACGTAAGAACGGTCCTCCATTAGGGTTCAAGAATCTCGGTAATACCTGCTACCTCAACTCCGTTCTCCAGTGCTTAACCTATACTCCTCCCCTCGCCAATTTCTGTCTCCAACTTCAACACTCCCTCTCCTGCGATTCCGTGGCTCAGCAGGACAAGAAGAGTGATTGTCCGTTTTGCTTACTAGAGAAGAGAATTGTTCGATCTCTTAG...

Protein

Download Protein FASTA

557 aa · TkA04G358450|TK1151|PROTEIN

MAGFQLQMTWQTNLLKKRKNGPPLGFKNLGNTCYLNSVLQCLTYTPPLANFCLQLQHSLSCDSVAQQDKKSDCPFCLLEKRIVRSLSIDSTLDTPGKIISGLKIFAEHFRQGRQEDAHEFLRYVIDACHTTSLRLKKLQQQRRKYVSNGGGDGVSGSTVVKEIFGGALQSQVKCLTCGNESNKVDEIMDISVDVLNSSSLKEAFQKFFQPEILDGNNKYKCDSCKKLVAARKQMSIVQAPNILVIQLKRFEGIFGGKIDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G358450`
TK1151 ID	TkA04G358450
OH-1004 ID	LXL04_037890
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G358450

Location Chr04:90321123-90325779 (+)

Description Similar to UBP25: Ubiquitin carboxyl-terminal hydrolase 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14400`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037890 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006508 proteolysis Biological Process

GO:0007000 nucleolus organization Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0016242 negative regulation of macroautophagy Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0050821 protein stabilization Biological Process

GO:1901524 regulation of mitophagy Biological Process

GO:1903955 positive regulation of protein targeting to mitochondrion Biological Process

GO:2000232 regulation of rRNA processing Biological Process

KEGG gene cross-reference

ath:AT3G14400

hsa:57602

hsa:84132

mmu:72344

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.854

Rank 1 · TkA04G358450 · TK1151

Cytoplasm0.215

Rank 2 · TkA04G358450 · TK1151

Cell membrane0.041

Rank 3 · TkA04G358450 · TK1151

Mitochondrion0.039

Rank 4 · TkA04G358450 · TK1151

Endoplasmic reticulum0.023

Rank 5 · TkA04G358450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00443UCH25-340 aa

PF13423UCH_125-322 aa

PF30124F10E9_2_M93-103 aa

PF30124F10E9_2_M220-230 aa

PF30124F10E9_2_M299-305 aa

PF10163EnY2484-554 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G358450	`PF00443`	UCH	25	340	2.3e-54	185.4
TkA04G358450	`PF13423`	UCH_1	25	322	6.4e-18	66.2
TkA04G358450	`PF30124`	F10E9_2_M	93	103	1.4	9.4
TkA04G358450	`PF30124`	F10E9_2_M	220	230	1.4	9.4
TkA04G358450	`PF30124`	F10E9_2_M	299	305	1.4	9.4
TkA04G358450	`PF10163`	EnY2	484	554	0.0018	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FPS2`	Arabidopsis thaliana	sp\|Q9FPS2\|UBP25_ARATH Ubiquitin carboxyl-terminal hydrolase 25	72.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card